You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePeroxisomal carnitine O-octanoyltransferase
Synonyms
  • 2.3.1.137
  • COT
Gene NameCROT
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000743|Peroxisomal carnitine O-octanoyltransferase
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQS
GIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGT
QLERGSITLWHNLNYWQLLRKEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYF
RTESEGRSPNHIVVLCRGRAFVFDVIHEGCLVTPPELLRQLTYIHKKCHSEPDGPGIAAL
TSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMEDSSPHVTPEDYSEIIAAILIG
DPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVR
DIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI
QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQ
QKMLQAFAKHNKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFV
LSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAF
HDMIQLMNSTHL
Number of residues612
Molecular Weight70177.935
Theoretical pI7.09
GO Classification
Functions
  • receptor binding
  • carnitine O-octanoyltransferase activity
Processes
  • generation of precursor metabolites and energy
  • fatty acid beta-oxidation
  • small molecule metabolic process
  • coenzyme A metabolic process
  • carnitine metabolic process
  • cellular lipid metabolic process
  • fatty acid metabolic process
  • fatty acid transport
  • fatty acid beta-oxidation using acyl-CoA oxidase
  • medium-chain fatty acid metabolic process
Components
  • mitochondrion
  • peroxisome
  • intracellular membrane-bounded organelle
  • peroxisomal matrix
General FunctionReceptor binding
Specific FunctionBeta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID6066280
UniProtKB IDQ9UKG9
UniProtKB Entry NameOCTC_HUMAN
Cellular LocationPeroxisome
Gene sequence
>lcl|BSEQ0016074|Peroxisomal carnitine O-octanoyltransferase (CROT)
ATGGAAAATCAATTGGCTAAATCAACTGAAGAACGAACATTTCAGTACCAGGATTCTCTT
CCATCACTGCCTGTTCCTTCACTTGAAGAATCATTAAAAAAATACCTTGAATCAGTCACC
AGAACATGCTACCAGATAAGGGGTCTTGATCCAGATGCTAAGAGAGGGTTCTTGGATCTC
ACGCGGGAAGGAATTCAAGTGAAACCATTTGCAAATCAAGAAGAATATAAGAAAACTGAA
GAAATAGTTCAAAAATTTCAAAGTGGGATTGGAGAAAAATTGCACCAGAAATTGCTTGAA
AGAGCAAAAGGAAAAAGAAATTGGCTGGAAGAGTGGTGGCTGAATGTTGCCTATCTGGAT
GTTCGTATACCATCACAATTGAATGTCAACTTTGCGGGTCCTGCAGCTCATTTTGAACAC
TACTGGCCTCCAAAGGAAGGGACTCAATTAGAAAGAGGAAGTATAACTCTTTGGCATAAC
TTGAACTACTGGCAGCTATTAAGAAAAGAAAAAGTGCCTGTTCATAAAGTTGGAAATACT
CCTCTAGATATGAATCAATTCCGAATGCTATTTTCTACCTGCAAGGTTCCAGGAATTACT
AGAGACTCCATTATGAATTATTTTAGGACTGAGAGTGAAGGGCGTTCCCCAAACCACATT
GTAGTGCTGTGTCGAGGCCGAGCTTTTGTCTTTGATGTAATACATGAAGGATGTTTGGTC
ACCCCGCCAGAGCTTCTCAGACAACTGACATATATCCACAAGAAGTGCCATAGTGAACCT
GATGGACCTGGGATTGCAGCATTAACTAGTGAGGAGCGAACTCGATGGGCTAAGGCACGA
GAATATCTGATTGGTCTTGATCCAGAGAACTTGGCTTTGTTAGAAAAAATTCAGAGTAGT
TTACTGGTATATTCCATGGAGGATAGCAGTCCACATGTAACACCAGAGGATTATTCTGAG
ATTATTGCAGCCATCCTTATTGGAGATCCAACAGTACGCTGGGGTGACAAATCCTATAAC
TTGATTTCCTTTTCTAATGGAGTATTTGGCTGTAATTGTGATCATGCTCCTTTTGATGCA
ATGATTATGGTGAACATCAGTTATTATGTGGATGAGAAAATTTTTCAGAATGAAGGAAGA
TGGAAGGGTTCAGAGAAGGTACGAGATATACCACTTCCAGAAGAGCTCATTTTCATTGTG
GATGAGAAAGTTTTAAATGACATCAACCAAGCTAAAGCCCAGTATCTCAGGGAGGCATCT
GATCTACAGATTGCGGCTTATGCCTTTACATCTTTTGGCAAAAAGCTAACCAAGAACAAG
ATGCTTCACCCGGATACGTTTATTCAGCTTGCACTTCAGCTGGCCTATTACAGACTTCAT
GGACACCCTGGTTGTTGCTATGAAACAGCTATGACAAGACATTTTTATCATGGCCGTACA
GAGACTATGCGATCATGCACAGTTGAAGCAGTGAGGTGGTGCCAGTCCATGCAGGATCCT
TCTGTCAATCTTCGTGAGCGGCAGCAAAAGATGTTACAAGCTTTTGCAAAGCATAATAAA
ATGATGAAAGATTGTTCAGCTGGAAAAGGATTTGATCGTCACCTTTTAGGTCTCTTACTC
ATAGCAAAAGAGGAAGGTCTTCCTGTTCCAGAACTCTTTACGGACCCACTTTTTTCCAAA
AGCGGAGGAGGTGGAAATTTTGTTCTCTCAACAAGTCTGGTTGGCTATTTACGAGTCCAG
GGAGTGGTAGTTCCCATGGTACACAATGGTTATGGATTTTTCTACCATATCAGAGATGAC
AGGTTTGTTGTGGCCTGTTCAGCCTGGAAATCCTGTCCCGAGACTGATGCGGAAAAGCTA
GTTCAGCTGACTTTTTGTGCTTTTCATGATATGATACAGCTGATGAACTCTACTCATCTT
TAG
GenBank Gene IDAF168793
GeneCard IDNot Available
GenAtlas IDCROT
HGNC IDHGNC:2366
Chromosome Location7
Locus7q21.1
References
  1. Ferdinandusse S, Mulders J, IJlst L, Denis S, Dacremont G, Waterham HR, Wanders RJ: Molecular cloning and expression of human carnitine octanoyltransferase: evidence for its role in the peroxisomal beta-oxidation of branched-chain fatty acids. Biochem Biophys Res Commun. 1999 Sep 16;263(1):213-8. 10486279
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  3. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. 12690205
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  6. Morillas M, Gomez-Puertas P, Rubi B, Clotet J, Arino J, Valencia A, Hegardt FG, Serra D, Asins G: Structural model of a malonyl-CoA-binding site of carnitine octanoyltransferase and carnitine palmitoyltransferase I: mutational analysis of a malonyl-CoA affinity domain. J Biol Chem. 2002 Mar 29;277(13):11473-80. Epub 2002 Jan 14. 11790793