You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGlutamate receptor ionotropic, delta-1
Synonyms
  • GluD1
  • KIAA1220
Gene NameGRID1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004472|Glutamate receptor ionotropic, delta-1
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF
KYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS
VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPS
ASATLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSR
MDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADN
CVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPY
RDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIEL
SALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSAT
MPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Number of residues1009
Molecular Weight112129.96
Theoretical pI6.67
GO Classification
Functions
  • ionotropic glutamate receptor activity
  • extracellular-glutamate-gated ion channel activity
Processes
  • ion transmembrane transport
  • social behavior
  • synaptic transmission, glutamatergic
  • ionotropic glutamate receptor signaling pathway
Components
  • plasma membrane
  • cell junction
  • extracellular exosome
  • dendrite
  • ionotropic glutamate receptor complex
  • postsynaptic membrane
General FunctionIonotropic glutamate receptor activity
Specific FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Pfam Domain Function
Transmembrane Regions563-583 638-658 831-851
GenBank Protein ID24657795
UniProtKB IDQ9ULK0
UniProtKB Entry NameGRID1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0011640|Glutamate receptor ionotropic, delta-1 (GRID1)
ATGGAAGCGCTGACGCTGTGGCTTCTCCCCTGGATATGCCAGTGCGTGTCGGTGCGGGCC
GACTCCATCATCCACATCGGTGCCATCTTCGAGGAGAACGCGGCCAAGGACGACAGGGTG
TTCCAGTTGGCGGTATCCGACCTGAGCCTCAACGATGACATCCTGCAGAGCGAGAAGATC
ACCTACTCCATCAAGGTCATCGAGGCCAACAACCCATTCCAGGCTGTGCAGGAAGCCTGT
GACCTCATGACCCAGGGGATTTTGGCCTTGGTCACGTCCACTGGCTGTGCATCTGCCAAT
GCCCTGCAGTCCCTCACGGATGCCATGCACATCCCACACCTCTTTGTCCAGCGCAACCCG
GGAGGGTCGCCACGCACCGCATGCCACCTGAACCCCAGCCCCGATGGTGAGGCCTACACA
CTGGCTTCGAGACCACCCGTCCGCCTCAATGATGTCATGCTCAGGCTGGTGACGGAGCTG
CGCTGGCAGAAGTTCGTCATGTTCTACGACAGCGAGTATGATATCCGTGGGCTTCAAAGC
TTTCTGGACCAGGCCTCGCGGCTGGGCCTTGACGTCTCTTTACAAAAGGTGGACAAGAAC
ATTAGCCACGTATTCACCAGCCTCTTCACCACGATGAAGACAGAGGAGCTGAATCGCTAC
CGGGACACGCTTCGCCGCGCCATCCTGCTGCTCAGCCCACAGGGAGCCCACTCCTTCATC
AACGAGGCCGTGGAGACCAACCTGGCTTCCAAGGACAGCCACTGGGTCTTTGTGAATGAG
GAAATCAGTGACCCGGAGATCCTGGATCTGGTCCATAGTGCCCTTGGAAGGATGACCGTG
GTCCGGCAAATCTTTCCGTCTGCAAAGGACAATCAGAAATGCACGAGGAACAACCACCGC
ATCTCCTCCCTGCTCTGCGACCCCCAGGAAGGCTACCTCCAGATGCTGCAGATCTCCAAC
CTCTATCTGTATGACAGTGTTCTGATGCTGGCCAACGCCTTTCACAGGAAGCTGGAGGAC
CGGAAGTGGCATAGCATGGCGAGCCTCAACTGCATACGGAAATCCACTAAGCCATGGAAT
GGTGGGAGGTCCATGCTGGATACCATCAAAAAGGGCCACATCACTGGCCTCACTGGGGTG
ATGGAGTTTCGGGAGGACAGTTCGAATCCCTATGTCCAGTTTGAAATCCTTGGCACTACC
TATAGTGAGACTTTTGGCAAAGACATGCGCAAGTTGGCGACATGGGACTCAGAGAAGGGC
TTGAATGGCAGCTTGCAAGAGAGGCCCATGGGCAGCCGCCTCCAAGGATTGACTCTTAAA
GTGGTGACTGTCTTGGAAGAGCCTTTCGTGATGGTGGCTGAGAACATCCTAGGACAGCCC
AAGCGCTACAAAGGGTTCTCCATAGATGTCCTGGATGCACTGGCCAAGGCTCTGGGCTTT
AAATATGAGATTTACCAAGCCCCTGATGGCAGGTACGGTCACCAGCTCCATAACACCTCC
TGGAACGGGATGATCGGGGAGCTCATCAGCAAGAGAGCAGACTTGGCCATCTCTGCCATC
ACCATCACCCCAGAGAGGGAGAGCGTTGTGGACTTCAGCAAGCGGTACATGGACTATTCA
GTGGGGATTCTAATTAAGAAGCCCGAGGAGAAAATCAGCATCTTCTCCCTCTTTGCTCCA
TTTGATTTCGCTGTGTGGGCCTGCATTGCAGCAGCCATCCCTGTGGTTGGTGTGCTGATA
TTTGTGTTGAACAGGATACAGGCTGTGAGGGCTCAGAGTGCTGCCCAGCCCAGGCCGTCA
GCTTCTGCCACTCTGCACAGCGCCATCTGGATTGTCTATGGAGCCTTCGTACAGCAAGGT
GGCGAATCTTCCGTGAACTCCATGGCCATGCGCATCGTGATGGGCAGCTGGTGGCTCTTC
ACGCTCATTGTGTGCTCCTCCTACACAGCCAACCTTGCTGCCTTCCTCACAGTGTCCAGG
ATGGACAACCCCATAAGGACTTTCCAGGACCTGTCCAAACAAGTGGAAATGTCTTATGGC
ACTGTCCGGGATTCTGCTGTATATGAGTACTTCCGAGCCAAGGGCACCAACCCCCTGGAG
CAGGACAGCACGTTTGCTGAACTCTGGCGGACCATCAGCAAGAACGGAGGGGCTGACAAC
TGCGTGTCCAGTCCTTCAGAAGGCATCAGGAAGGCAAAGAAGGGGAACTACGCCTTCCTG
TGGGATGTGGCCGTGGTGGAATACGCAGCCCTGACGGATGACGACTGCTCGGTGACTGTC
ATCGGCAACAGCATCAGCAGCAAGGGTTACGGGATTGCCCTGCAGCATGGCAGCCCCTAC
AGGGACCTCTTCTCCCAGAGGATCCTGGAGCTGCAGGACACAGGGGACCTGGATGTGCTG
AAGCAGAAGTGGTGGCCGCACATGGGCCGCTGTGACCTCACCAGCCATGCCAGCGCCCAG
GCCGACGGCAAATCCCTCAAGCTGCACAGCTTCGCCGGGGTCTTCTGCATCCTGGCCATT
GGCCTGCTCCTGGCCTGCCTGGTGGCTGCCCTGGAGTTGTGGTGGAACAGCAACCGGTGC
CACCAGGAGACCCCCAAGGAGGACAAAGAAGTGAACTTGGAGCAGGTCCACCGGCGCATG
AACAGCCTCATGGATGAAGACATTGCTCACAAGCAGATTTCCCCAGCGTCGATTGAGCTC
TCGGCCCTGGAGATGGGGGGCCTGGCTCCCACCCAGACCTTGGAGCCGACACGGGAGTAC
CAGAACACCCAGCTCTCGGTCAGCACCTTTCTGCCAGAGCAGAGCAGCCATGGCACCAGC
CGGACACTCTCATCAGGGCCCAGCAGCAACCTGCCGCTGCCGCTGAGCAGCTCGGCGACC
ATGCCCTCCATGCAGTGCAAACACAGGTCACCCAACGGGGGGCTGTTCCGGCAGAGCCCG
GTGAAGACCCCCATCCCCATGTCCTTCCAGCCCGTGCCTGGAGGCGTCCTTCCAGAGGCT
CTGGACACCTCCCACGGGACCTCCATCTGA
GenBank Gene IDBC039263
GeneCard IDNot Available
GenAtlas IDGRID1
HGNC IDHGNC:4575
Chromosome Location10
Locus10q22
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. 10574462