You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein-arginine deiminase type-3
Synonyms
  • 3.5.3.15
  • PAD3
  • PDI3
  • Peptidylarginine deiminase III
  • Protein-arginine deiminase type III
Gene NamePADI3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016753|Protein-arginine deiminase type-3
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGR
ERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLD
CDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDVQDNCDQHVHCLQDLEDM
SVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVP
RLHGDEERFFVEGLSFPDAGFTGLISFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQKVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINY
NKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTERKKATAFFPDLVNMLVLGKHLGIP
KPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVCRKPFSFKWW
NMVP
Number of residues664
Molecular Weight74742.705
Theoretical pI5.22
GO Classification
Functions
  • calcium ion binding
  • protein-arginine deiminase activity
Processes
  • protein citrullination
Components
  • cytoplasm
General FunctionProtein-arginine deiminase activity
Specific FunctionCatalyzes the deimination of arginine residues of proteins.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID6172379
UniProtKB IDQ9ULW8
UniProtKB Entry NamePADI3_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0016754|Protein-arginine deiminase type-3 (PADI3)
ATGTCGCTGCAGAGAATCGTGCGTGTGTCCCTGGAGCATCCCACCAGCGCGGTGTGTGTG
GCTGGCGTGGAGACCCTCGTGGACATTTATGGGTCAGTGCCTGAGGGCACAGAAATGTTT
GAGGTCTATGGGACGCCTGGCGTGGACATCTACATCTCTCCCAACATGGAGAGGGGCCGG
GAGCGTGCAGACACCAGGCGGTGGCGCTTTGACGCGACTTTGGAGATCATCGTGGTCATG
AACTCCCCCAGCAATGACCTCAACGACAGCCATGTTCAGATTTCCTACCACTCCAGCCAT
GAGCCTCTGCCCCTGGCCTATGCGGTGCTCTACCTCACCTGTGTTGACATCTCTCTGGAT
TGCGACCTGAACTGTGAGGGAAGGCAGGACAGGAACTTTGTAGACAAGCGGCAGTGGGTC
TGGGGGCCCAGTGGGTATGGCGGCATCTTGCTGGTGAACTGTGACCGTGATGATCCGAGC
TGTGATGTCCAGGACAATTGTGACCAGCACGTGCACTGCCTGCAAGACCTGGAAGACATG
TCTGTCATGGTCCTGCGGACGCAGGGCCCTGCAGCCCTCTTTGATGACCACAAACTTGTC
CTCCATACCTCCAGCTATGATGCCAAACGGGCACAGGTCTTCCACATCTGCGGTCCTGAG
GATGTGTGTGAGGCCTATAGGCATGTGCTGGGCCAAGATAAGGTGTCCTATGAGGTACCC
CGCTTGCATGGGGATGAGGAGCGCTTCTTCGTGGAAGGCCTGTCCTTCCCTGATGCCGGC
TTCACAGGACTCATCTCCTTCCATGTCACTCTGCTGGACGACTCCAACGAGGATTTCTCG
GCATCCCCTATCTTCACTGACACTGTGGTGTTCCGAGTGGCACCCTGGATCATGACGCCC
AGCACTCTGCCACCCCTAGAGGTGTATGTGTGCCGTGTGAGGAACAACACGTGTTTTGTG
GATGCGGTGGCAGAGCTGGCCAGGAAGGCCGGCTGCAAGCTGACCATCTGCCCACAGGCC
GAGAACCGCAACGACCGCTGGATCCAGGATGAGATGGAGCTGGGCTACGTTCAGGCGCCG
CACAAGACCCTCCCGGTGGTCTTTGACTCCCCAAGGAATGGGGAACTGCAGGATTTCCCT
TACAAAAGAATCCTGGGTCCAGATTTTGGTTACGTGACTCGGGAACCACGCGACAGGTCT
GTGAGTGGCCTGGACTCCTTTGGGAACCTGGAGGTCAGCCCTCCAGTGGTGGCCAATGGG
AAAGAGTACCCCCTGGGGAGGATCCTCATTGGGGGCAACCTGCCTGGGTCAAGTGGCCGC
AGGGTCACCCAGGTGGTGCGGGACTTCCTCCATGCCCAGAAGGTGCAGCCCCCCGTGGAG
CTCTTTGTGGACTGGTTGGCCGTGGGCCATGTGGATGAGTTTCTGAGCTTTGTCCCTGCC
CCCGATGGGAAGGGCTTCCGGATGCTCCTGGCCAGCCCTGGGGCCTGCTTCAAGCTCTTC
CAGGAAAAGCAGAAGTGTGGCCACGGGAGGGCCCTCCTGTTCCAGGGGGTTGTTGATGAT
GAGCAGGTCAAGACCATCTCCATCAACCAGGTGCTCTCCAATAAAGACCTCATCAACTAC
AATAAGTTTGTGCAGAGCTGCATCGACTGGAACCGTGAGGTGCTGAAGCGGGAGCTGGGC
CTGGCAGAGTGTGACATCATTGACATCCCACAGCTCTTCAAGACCGAGAGGAAAAAAGCA
ACGGCCTTCTTCCCTGACTTGGTGAACATGCTGGTGCTGGGGAAGCACCTGGGCATCCCC
AAGCCCTTTGGGCCCATCATCAATGGCTGCTGCTGCCTGGAGGAGAAGGTGCGGTCCCTG
CTGGAGCCGCTGGGCCTCCACTGCACCTTCATTGATGACTTCACTCCATACCACATGCTG
CATGGGGAGGTGCACTGTGGCACCAATGTGTGCAGAAAGCCCTTCTCTTTCAAGTGGTGG
AACATGGTGCCCTGA
GenBank Gene IDAB026831
GeneCard IDNot Available
GenAtlas IDPADI3
HGNC IDHGNC:18337
Chromosome Location1
Locus1p36.13
References
  1. Kanno T, Kawada A, Yamanouchi J, Yosida-Noro C, Yoshiki A, Shiraiwa M, Kusakabe M, Manabe M, Tezuka T, Takahara H: Human peptidylarginine deiminase type III: molecular cloning and nucleotide sequence of the cDNA, properties of the recombinant enzyme, and immunohistochemical localization in human skin. J Invest Dermatol. 2000 Nov;115(5):813-23. 11069618
  2. Chavanas S, Mechin MC, Takahara H, Kawada A, Nachat R, Serre G, Simon M: Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6. Gene. 2004 Apr 14;330:19-27. 15087120
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974