You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameC-Jun-amino-terminal kinase-interacting protein 1
Synonyms
  • IB-1
  • IB1
  • Islet-brain 1
  • JIP-1
  • JIP1
  • JNK MAP kinase scaffold protein 1
  • Mitogen-activated protein kinase 8-interacting protein 1
  • PRKM8IP
Gene NameMAPK8IP1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019471|C-Jun-amino-terminal kinase-interacting protein 1
MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISL
QCKDTLSLRPPRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAAR
RPGAGPPKAESGQEPASRGQGQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNN
SLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRS
TATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFL
PPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPP
PPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVS
SPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLF
SCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFP
AYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLT
VHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFI
TKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE
Number of residues711
Molecular Weight77523.56
Theoretical pI4.61
GO Classification
Functions
  • kinesin binding
  • MAP-kinase scaffold activity
  • protein kinase inhibitor activity
Processes
  • negative regulation of intrinsic apoptotic signaling pathway
  • positive regulation of signal transduction
  • regulation of JNK cascade
  • negative regulation of cyclin-dependent protein kinase activity
  • JUN phosphorylation
  • vesicle-mediated transport
  • regulation of transcription, DNA-templated
Components
  • cytoplasm
  • nucleus
  • endoplasmic reticulum membrane
  • dentate gyrus mossy fiber
  • mitochondrial membrane
  • cytosol
  • perinuclear region of cytoplasm
  • dendrite
  • synapse
  • cell body
General FunctionProtein kinase inhibitor activity
Specific FunctionThe JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. Required for JNK activation in response to excitotoxic stress. Cytoplasmic MAPK8IP1 causes inhibition of JNK-regulated activity by retaining JNK in the cytoplasm and inhibiting JNK phosphorylation of c-Jun. May also participate in ApoER2-specific reelin signaling. Directly, or indirectly, regulates GLUT2 gene expression and beta-cell function. Appears to have a role in cell signaling in mature and developing nerve terminals. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity). Functions as an anti-apoptotic protein and whose level seems to influence the beta-cell death or survival response.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID4426597
UniProtKB IDQ9UQF2
UniProtKB Entry NameJIP1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019472|C-Jun-amino-terminal kinase-interacting protein 1 (MAPK8IP1)
ATGGCGGAGCGAGAAAGCGGCGGCCTGGGAGGGGGGGCCGCGTCCCCGCCCGCCGCCTCC
CCGTTCCTGGGGCTGCACATCGCTTCGCCTCCCAATTTCAGGCTCACCCATGACATCAGC
CTGGAGGAGTTTGAGGATGAAGACCTCTCGGAGATCACTGATGAGTGTGGCATCAGCTTA
CAGTGCAAAGACACCCTGTCCTTACGGCCCCCGCGCGCCGGGCTGCTCTCTGCGGGCGGC
GGCGGCGCGGGGAGCCGGTTGCAGGCCGAGATGCTGCAGATGGACCTGATCGACGCGACG
GGGGACACTCCCGGGGCCGAGGACGACGAGGAGGACGACGACGAGGAGCGCGCGGCCCGG
CGGCCGGGAGCGGGGCCGCCCAAGGCCGAGTCCGGCCAGGAGCCGGCGTCCCGCGGCCAG
GGCCAGAGCCAAGGCCAGAGCCAGGGCCCGGGCAGCGGGGACACGTACCGGCCCAAGCGG
CCCACCACGCTCAACCTCTTTCCGCAGGTGCCGCGGTCTCAGGACACACTGAATAATAAT
TCTCTGGGCAAAAAGCACAGTTGGCAGGATCGGGTGTCTCGATCATCCTCACCCCTGAAG
ACAGGGGAGCAGACACCACCGCATGAACACATCTGCCTGAGCGATGAGCTGCCCCCCCAG
AGCGGCCCCGCCCCCACCACAGATCGAGGCACCTCCACCGACAGCCCTTGCCGCCGCAGC
ACAGCCACCCAGATGGCACCTCCGGGTGGTCCCCCTGCTGCCCCGCCTGGGGGTCGGGGC
CACTCGCATCGAGACCGAATCCACTACCAGGCCGATGTGCGACTAGAGGCCACTGAGGAG
ATCTACCTGACCCCAGTGCAGAGGCCCCCAGACGCTGCAGAGCCCACCTCCGCCTTCCTG
CCGCCCACTGAGAGCCGGATGTCAGTCAGCTCCGATCCAGACCCTGCCGCCTACCCCTCC
ACGGCAGGGCGGCCGCACCCCTCCATCAGTGAAGAGGAAGAGGGCTTCGACTGCCTGTCG
TCCCCAGAGCGGGCTGAGCCCCCAGGCGGAGGGTGGCGGGGGAGCCTGGGGGAGCCGCCG
CCACCTCCACGGGCCTCTCTGAGCTCGGACACCAGCGCCCTGTCCTATGACTCTGTCAAG
TACACGCTGGTGGTAGATGAGCATGCACAGCTGGAGCTGGTGAGCCTGCGGCCGTGCTTC
GGAGACTACAGTGACGAGAGTGACTCTGCCACCGTCTATGACAACTGTGCCTCCGTCTCC
TCGCCCTATGAGTCGGCCATCGGAGAGGAATATGAGGAGGCCCCGCGGCCCCAGCCCCCT
GCCTGCCTCTCCGAGGACTCCACGCCTGATGAACCCGACGTCCATTTCTCCAAGAAATTC
CTGAACGTCTTCATGAGTGGCCGCTCCCGCTCCTCCAGTGCTGAGTCCTTCGGGCTGTTC
TCCTGCATCATCAACGGGGAGGAGCAGGAGCAGACCCACCGGGCCATATTCAGGTTTGTG
CCTCGACACGAAGACGAACTTGAGCTGGAAGTGGATGACCCTCTGCTAGTGGAGCTCCAG
GCTGAAGACTACTGGTACGAGGCCTACAACATGCGCACTGGTGCCCGGGGTGTCTTTCCT
GCCTATTACGCCATCGAGGTCACCAAGGAGCCCGAGCACATGGCAGCCCTGGCCAAAAAC
AGTGACTGGGTGGACCAGTTCCGGGTGAAGTTCCTGGGCTCAGTCCAGGTTCCCTATCAC
AAGGGCAATGACGTCCTCTGTGCTGCTATGCAAAAGATTGCCACCACCCGCCGGCTCACC
GTGCACTTTAACCCGCCCTCCAGCTGTGTCCTGGAGATCAGCGTGCGGGGTGTGAAGATA
GGCGTCAAGGCCGATGACTCCCAGGAGGCCAAGGGGAATAAATGTAGCCACTTTTTCCAG
TTAAAAAACATCTCTTTCTGCGGATATCATCCAAAGAACAACAAGTACTTTGGGTTCATC
ACCAAGCACCCCGCCGACCACCGGTTTGCCTGCCACGTCTTTGTGTCTGAAGACTCCACC
AAAGCCCTGGCAGAGTCCGTGGGGAGAGCATTCCAGCAGTTCTACAAGCAGTTTGTGGAG
TACACCTGCCCCACAGAAGATATCTACCTGGAGTAG
GenBank Gene IDAF074091
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6882
Chromosome Location11
Locus11p12-p11.2
References
  1. Mooser V, Maillard A, Bonny C, Steinmann M, Shaw P, Yarnall DP, Burns DK, Schorderet DF, Nicod P, Waeber G: Genomic organization, fine-mapping, and expression of the human islet-brain 1 (IB1)/c-Jun-amino-terminal kinase interacting protein-1 (JIP-1) gene. Genomics. 1999 Jan 15;55(2):202-8. 9933567
  2. Meyer D, Liu A, Margolis B: Interaction of c-Jun amino-terminal kinase interacting protein-1 with p190 rhoGEF and its localization in differentiated neurons. J Biol Chem. 1999 Dec 3;274(49):35113-8. 10574993
  3. Verhey KJ, Meyer D, Deehan R, Blenis J, Schnapp BJ, Rapoport TA, Margolis B: Cargo of kinesin identified as JIP scaffolding proteins and associated signaling molecules. J Cell Biol. 2001 Mar 5;152(5):959-70. 11238452
  4. Ikeda A, Hasegawa K, Masaki M, Moriguchi T, Nishida E, Kozutsumi Y, Oka S, Kawasaki T: Mixed lineage kinase LZK forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway. J Biochem. 2001 Dec;130(6):773-81. 11726277
  5. Taru H, Iijima K, Hase M, Kirino Y, Yagi Y, Suzuki T: Interaction of Alzheimer's beta -amyloid precursor family proteins with scaffold proteins of the JNK signaling cascade. J Biol Chem. 2002 May 31;277(22):20070-8. Epub 2002 Mar 22. 11912189
  6. Nihalani D, Wong HN, Holzman LB: Recruitment of JNK to JIP1 and JNK-dependent JIP1 phosphorylation regulates JNK module dynamics and activation. J Biol Chem. 2003 Aug 1;278(31):28694-702. Epub 2003 May 19. 12756254
  7. Bonny C, Oberson A, Negri S, Sauser C, Schorderet DF: Cell-permeable peptide inhibitors of JNK: novel blockers of beta-cell death. Diabetes. 2001 Jan;50(1):77-82. 11147798
  8. Allaman-Pillet N, Storling J, Oberson A, Roduit R, Negri S, Sauser C, Nicod P, Beckmann JS, Schorderet DF, Mandrup-Poulsen T, Bonny C: Calcium- and proteasome-dependent degradation of the JNK scaffold protein islet-brain 1. J Biol Chem. 2003 Dec 5;278(49):48720-6. Epub 2003 Sep 24. 14507925
  9. Borsello T, Clarke PG, Hirt L, Vercelli A, Repici M, Schorderet DF, Bogousslavsky J, Bonny C: A peptide inhibitor of c-Jun N-terminal kinase protects against excitotoxicity and cerebral ischemia. Nat Med. 2003 Sep;9(9):1180-6. Epub 2003 Aug 24. 12937412
  10. D'Ambrosio C, Arena S, Fulcoli G, Scheinfeld MH, Zhou D, D'Adamio L, Scaloni A: Hyperphosphorylation of JNK-interacting protein 1, a protein associated with Alzheimer disease. Mol Cell Proteomics. 2006 Jan;5(1):97-113. Epub 2005 Sep 29. 16195223
  11. Blanco S, Santos C, Lazo PA: Vaccinia-related kinase 2 modulates the stress response to hypoxia mediated by TAK1. Mol Cell Biol. 2007 Oct;27(20):7273-83. Epub 2007 Aug 20. 17709393
  12. Blanco S, Sanz-Garcia M, Santos CR, Lazo PA: Modulation of interleukin-1 transcriptional response by the interaction between VRK2 and the JIP1 scaffold protein. PLoS One. 2008 Feb 20;3(2):e1660. doi: 10.1371/journal.pone.0001660. 18286207
  13. Waeber G, Delplanque J, Bonny C, Mooser V, Steinmann M, Widmann C, Maillard A, Miklossy J, Dina C, Hani EH, Vionnet N, Nicod P, Boutin P, Froguel P: The gene MAPK8IP1, encoding islet-brain-1, is a candidate for type 2 diabetes. Nat Genet. 2000 Mar;24(3):291-5. 10700186