You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHistone deacetylase 5
Synonyms
  • 3.5.1.98
  • Antigen NY-CO-9
  • HD5
  • KIAA0600
Gene NameHDAC5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037243|Histone deacetylase 5
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
Number of residues1122
Molecular Weight121976.855
Theoretical pI6.19
GO Classification
Functions
  • transcription corepressor activity
  • RNA polymerase III transcription factor binding
  • chromatin binding
  • core promoter binding
  • histone deacetylase binding
  • NAD-dependent histone deacetylase activity (H3-K14 specific)
  • protein kinase C binding
  • transcription factor binding
  • protein deacetylase activity
  • metal ion binding
  • histone deacetylase activity
  • repressing transcription factor binding
Processes
  • regulation of skeletal muscle fiber development
  • positive regulation of sequence-specific DNA binding transcription factor activity
  • negative regulation of transcription from RNA polymerase II promoter
  • chromatin organization
  • cellular response to insulin stimulus
  • response to drug
  • cellular response to lipopolysaccharide
  • response to cocaine
  • inflammatory response
  • transcription, DNA-templated
  • chromatin remodeling
  • Notch signaling pathway
  • histone deacetylation
  • protein deacetylation
  • negative regulation of transcription, DNA-templated
  • chromatin silencing
  • negative regulation of osteoblast differentiation
  • osteoblast development
  • neuron differentiation
  • B cell differentiation
  • regulation of myotube differentiation
  • multicellular organismal response to stress
  • negative regulation of myotube differentiation
  • B cell activation
  • heart development
  • negative regulation of cell migration involved in sprouting angiogenesis
  • chromatin modification
  • positive regulation of transcription from RNA polymerase II promoter
  • regulation of gene expression, epigenetic
  • response to activity
  • regulation of protein binding
Components
  • cytoplasm
  • nucleus
  • histone deacetylase complex
  • Golgi apparatus
  • cytosol
  • nucleoplasm
  • nuclear body
General FunctionTranscription factor binding
Specific FunctionResponsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9UQL6
UniProtKB Entry NameHDAC5_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021357|Histone deacetylase 5 (HDAC5)
ATGAACTCTCCCAACGAGTCGGCAGATGGGATGTCAGGTCGGGAACCATCCTTGGAAATC
CTGCCGCGGACTTCTCTGCACAGCATCCCTGTGACAGTGGAGGTGAAGCCGGTGCTGCCA
AGAGCCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTA
CGGGGGGCTCTGGTGGGCTCTGTGGACCCCACACTGCGGGAGCAGCAACTGCAGCAGGAG
CTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCTCCTGTTCGCTGAGTTCCAG
AAACAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAG
CAGCAGGAGATGCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAG
GAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGG
CTGGAGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCC
AGCACTGAGGTAAAGCTGAGGCTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACA
CCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATGCTGGGGAGCCCACCATGCT
TCTTTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAA
CTGCCTTTGCCTGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAAAACAGCCTCT
GAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGT
CCCCTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAG
ATCACAGGTGCCGGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCC
AGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCC
AACATCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAAC
CAGTTCAGCCTCTACACGTCTCCTTCTCTGCCCAACATCTCCCTAGGGCTGCAGGCCACG
GTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACAGCAGGAGGCC
GAGAGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGC
ACATCCTCTATTCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCAC
GGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACC
CTCATTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACC
AGCATGCGGACGGTAGGCAAGCTCCCGCGGCATCGGCCCCTGAGCCGCACTCAGTCCTCA
CCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCATGCAACAACAGCACCAGCAG
TTCCTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGG
GAGCTGCCCAGGCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAG
CAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGT
GAGAGCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAG
GATTGCATCCAGGTTAAGGACGAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTG
GAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGCCCAGCCGCTGCAGCCTTTG
CAGGTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACC
CAGTCCTCCCCTGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCCCGTCAAGCAC
CTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAAGCACCAGTGCATGTGCGGG
AACACACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAG
GAGACAGGCCTGCTTAGCAAGTGCGAGCGGATCCGAGGTCGCAAAGCCACGCTAGATGAG
ATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGGGACCAGTCCCCTCAACCGG
CAGAAGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTG
CCTTGTGGGGGCATCGGGGTGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGT
GCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGGCTGCAGGAGAG
CTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCC
ATGGGATTCTGCTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTG
AACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCATGGCAATGGCACCCAGCAG
GCGTTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAAC
TTCTTTCCAGGCTCTGGGGCTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAAT
GTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGGAGACGTGGAGTACCTTACA
GCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTC
TCCGCCGGGTTTGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACC
GCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTG
CTGGCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTC
TCGGCTCTGCTCAGTGTAGAGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCC
AACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGATCCAGAGCAAACACTGGAGC
TGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAG
ACCGAGGAGGCCGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCC
CAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAG
CCTGCCCTGTGA
GenBank Gene IDBK000028
GeneCard IDNot Available
GenAtlas IDHDAC5
HGNC IDHGNC:14068
Chromosome Location17
LocusNot Available
References
  1. Grozinger CM, Hassig CA, Schreiber SL: Three proteins define a class of human histone deacetylases related to yeast Hda1p. Proc Natl Acad Sci U S A. 1999 Apr 27;96(9):4868-73. 10220385
  2. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. 9628581
  3. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Scanlan MJ, Chen YT, Williamson B, Gure AO, Stockert E, Gordan JD, Tureci O, Sahin U, Pfreundschuh M, Old LJ: Characterization of human colon cancer antigens recognized by autologous antibodies. Int J Cancer. 1998 May 29;76(5):652-8. 9610721
  7. Mahlknecht U, Schnittger S, Ottmann OG, Schoch C, Mosebach M, Hiddemann W, Hoelzer D: Chromosomal organization and localization of the human histone deacetylase 5 gene (HDAC5). Biochim Biophys Acta. 2000 Oct 2;1493(3):342-8. 11018260
  8. Huynh KD, Fischle W, Verdin E, Bardwell VJ: BCoR, a novel corepressor involved in BCL-6 repression. Genes Dev. 2000 Jul 15;14(14):1810-23. 10898795
  9. McKinsey TA, Zhang CL, Lu J, Olson EN: Signal-dependent nuclear export of a histone deacetylase regulates muscle differentiation. Nature. 2000 Nov 2;408(6808):106-11. 11081517
  10. McKinsey TA, Zhang CL, Olson EN: Activation of the myocyte enhancer factor-2 transcription factor by calcium/calmodulin-dependent protein kinase-stimulated binding of 14-3-3 to histone deacetylase 5. Proc Natl Acad Sci U S A. 2000 Dec 19;97(26):14400-5. 11114197
  11. McKinsey TA, Zhang CL, Olson EN: Identification of a signal-responsive nuclear export sequence in class II histone deacetylases. Mol Cell Biol. 2001 Sep;21(18):6312-21. 11509672
  12. Hook SS, Orian A, Cowley SM, Eisenman RN: Histone deacetylase 6 binds polyubiquitin through its zinc finger (PAZ domain) and copurifies with deubiquitinating enzymes. Proc Natl Acad Sci U S A. 2002 Oct 15;99(21):13425-30. Epub 2002 Sep 27. 12354939
  13. Mascle X, Albagli O, Lemercier C: Point mutations in BCL6 DNA-binding domain reveal distinct roles for the six zinc fingers. Biochem Biophys Res Commun. 2003 Jan 10;300(2):391-6. 12504096
  14. Barrett A, Santangelo S, Tan K, Catchpole S, Roberts K, Spencer-Dene B, Hall D, Scibetta A, Burchell J, Verdin E, Freemont P, Taylor-Papadimitriou J: Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases. Int J Cancer. 2007 Jul 15;121(2):265-75. 17373667
  15. Ohoka N, Hattori T, Kitagawa M, Onozaki K, Hayashi H: Critical and functional regulation of CHOP (C/EBP homologous protein) through the N-terminal portion. J Biol Chem. 2007 Dec 7;282(49):35687-94. Epub 2007 Sep 14. 17872950
  16. McGee SL, van Denderen BJ, Howlett KF, Mollica J, Schertzer JD, Kemp BE, Hargreaves M: AMP-activated protein kinase regulates GLUT4 transcription by phosphorylating histone deacetylase 5. Diabetes. 2008 Apr;57(4):860-7. doi: 10.2337/db07-0843. Epub 2008 Jan 9. 18184930
  17. Ha CH, Wang W, Jhun BS, Wong C, Hausser A, Pfizenmaier K, McKinsey TA, Olson EN, Jin ZG: Protein kinase D-dependent phosphorylation and nuclear export of histone deacetylase 5 mediates vascular endothelial growth factor-induced gene expression and angiogenesis. J Biol Chem. 2008 May 23;283(21):14590-9. doi: 10.1074/jbc.M800264200. Epub 2008 Mar 10. 18332134
  18. Bierne H, Tham TN, Batsche E, Dumay A, Leguillou M, Kerneis-Golsteyn S, Regnault B, Seeler JS, Muchardt C, Feunteun J, Cossart P: Human BAHD1 promotes heterochromatic gene silencing. Proc Natl Acad Sci U S A. 2009 Aug 18;106(33):13826-31. doi: 10.1073/pnas.0901259106. Epub 2009 Aug 3. 19666599
  19. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  20. Harrison BC, Huynh K, Lundgaard GL, Helmke SM, Perryman MB, McKinsey TA: Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases. FEBS Lett. 2010 Mar 19;584(6):1103-10. doi: 10.1016/j.febslet.2010.02.057. Epub 2010 Feb 24. 20188095
  21. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  22. Kang HJ, Lee MH, Kang HL, Kim SH, Ahn JR, Na H, Na TY, Kim YN, Seong JK, Lee MO: Differential regulation of estrogen receptor alpha expression in breast cancer cells by metastasis-associated protein 1. Cancer Res. 2014 Mar 1;74(5):1484-94. doi: 10.1158/0008-5472.CAN-13-2020. Epub 2014 Jan 10. 24413532
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569