You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePhenylalanine--tRNA ligase alpha subunit
Synonyms
  • 6.1.1.20
  • CML33
  • FARS
  • FARSL
  • FARSLA
  • Phenylalanyl-tRNA synthetase alpha subunit
  • PheRS
Gene NameFARSA
OrganismHuman
Amino acid sequence
>lcl|BSEQ0036942|Phenylalanine--tRNA ligase alpha subunit
MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKH
WELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSA
FSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTH
SQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVF
SYHQGLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDAEPRPPPTQEAA
Number of residues508
Molecular Weight57563.225
Theoretical pI7.96
GO Classification
Functions
  • ATP binding
  • phenylalanine-tRNA ligase activity
  • tRNA binding
  • poly(A) RNA binding
Processes
  • tRNA aminoacylation for protein translation
  • phenylalanyl-tRNA aminoacylation
  • gene expression
Components
  • cytoplasm
  • membrane
  • cytosol
  • phenylalanine-tRNA ligase complex
General FunctionTrna binding
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID2102679
UniProtKB IDQ9Y285
UniProtKB Entry NameSYFA_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0018913|Phenylalanine--tRNA ligase alpha subunit (FARSA)
ATGGCGGATGGTCAGGTGGCGGAACTGCTGCTCCGGCGGCTGGAGGCGTCTGATGGCGGC
CTGGACAGCGCCGAGTTGGCGGCTGAGCTGGGCATGGAGCACCAGGCGGTGGTGGGCGCC
GTGAAGAGCCTTCAGGCGCTGGGCGAGGTCATCGAGGCTGAACTTCGGTCCACCAAGCAC
TGGGAGCTTACTGCGGAGGGCGAGGAGATTGCCCGGGAGGGCAGCCATGAGGCCCGTGTG
TTTCGAAGCATTCCCCCAGAGGGCCTGGCCCAGAGCGAGCTTATGCGACTGCCCAGTGGC
AAAGTGGGCTTCAGCAAGGCCATGTCCAACAAGTGGATTCGGGTGGACAAGAGTGCGGCT
GACGGGCCCCGGGTGTTCCGAGTGGTGGACAGCATGGAGGATGAGGTGCAGCGGCGGCTC
CAGCTGGTCCGGGGGGGACAGGCTGAGAAGCTGGGGGAGAAGGAGAGGAGCGAGCTGAGG
AAGAGGAAGCTGTTGGCTGAAGTGACTCTGAAGACCTACTGGGTGAGCAAAGGCAGTGCC
TTTAGTACCAGCATCTCCAAGCAAGAGACAGAGCTGAGCCCAGAGATGATCTCCAGTGGC
TCTTGGCGGGACCGGCCCTTCAAGCCCTACAACTTCTTGGCCCACGGTGTCCTCCCCGAC
AGCGGCCACCTTCACCCGCTGCTCAAGGTCCGCTCCCAGTTCCGACAGATCTTCCTGGAG
ATGGGGTTCACCGAGATGCCGACTGATAACTTCATTGAGAGCTCCTTCTGGAACTTTGAC
GCCCTCTTCCAGCCCCAGCAGCACCCAGCCCGTGACCAGCACGACACCTTCTTCCTTCGA
GATCCAGCGGAGGCCCTGCAGCTCCCAATGGACTATGTCCAGCGGGTCAAGCGGACCCAC
TCTCAGGGCGGCTACGGCTCACAGGGGTACAAGTATAACTGGAAGCTGGACGAGGCCCGG
AAAAACCTACTGCGAACCCACACCACATCAGCCAGCGCCCGTGCGCTCTACCGCCTTGCC
CAGAAGAAGCCCTTCACTCCGGTCAAGTACTTCTCCATCGACCGCGTATTCCGGAATGAG
ACCCTGGACGCCACGCACCTGGCTGAGTTCCACCAGATCGAGGGCGTGGTGGCGGATCAT
GGTCTCACCTTGGGCCACCTCATGGGCGTTCTGCGGGAGTTCTTCACCAAGCTGGGTATC
ACGCAACTCCGCTTCAAGCCAGCCTACAACCCATACACAGAGCCCAGCATGGAGGTGTTC
AGCTACCACCAAGGCCTGAAGAAGTGGGTGGAGGTCGGAAACTCGGGGGTCTTCCGTCCA
GAGATGCTGCTGCCCATGGGGCTTCCCGAGAACGTGTCGGTCATTGCCTGGGGCCTCTCC
CTGGAGCGCCCAACGATGATCAAATATGGCATCAACAATATCCGGGAGCTGGTGGGCCAC
AAGGTGAACCTGCAGATGGTGTATGACAGTCCCCTGTGCCGCCTGGATGCCGAGCCGAGG
CCCCCTCCCACACAGGAGGCTGCGTGA
GenBank Gene IDU07424
GeneCard IDNot Available
GenAtlas IDFARSLA
HGNC IDHGNC:3592
Chromosome Location19
Locus19p13.2
References
  1. Sen S, Zhou H, Ripmaster T, Hittelman WN, Schimmel P, White RA: Expression of a gene encoding a tRNA synthetase-like protein is enhanced in tumorigenic human myeloid leukemia cells and is cell cycle stage- and differentiation-dependent. Proc Natl Acad Sci U S A. 1997 Jun 10;94(12):6164-9. 9177188
  2. Rodova M, Ankilova V, Safro MG: Human phenylalanyl-tRNA synthetase: cloning, characterization of the deduced amino acid sequences in terms of the structural domains and coordinately regulated expression of the alpha and beta subunits in chronic myeloid leukemia cells. Biochem Biophys Res Commun. 1999 Feb 24;255(3):765-73. 10049785
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. 12665801
  7. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  9. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  11. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. 22223895
  12. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  13. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712