You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein-arginine deiminase type-2
Synonyms
  • 3.5.3.15
  • KIAA0994
  • PAD-H19
  • PAD2
  • PDI2
  • Peptidylarginine deiminase II
  • Protein-arginine deiminase type II
Gene NamePADI2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004548|Protein-arginine deiminase type-2
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
Number of residues665
Molecular Weight75563.35
Theoretical pI5.28
GO Classification
Functions
  • protein-arginine deiminase activity
  • estrogen receptor binding
  • calcium ion binding
Processes
  • substantia nigra development
  • chromatin-mediated maintenance of transcription
  • protein citrullination
  • intracellular estrogen receptor signaling pathway
  • histone H3-R26 citrullination
  • negative regulation of chemokine-mediated signaling pathway
  • negative regulation of lymphocyte chemotaxis
  • regulation of chromatin disassembly
Components
  • extracellular exosome
  • transcriptionally active chromatin
  • cytoplasm
General FunctionProtein-arginine deiminase activity
Specific FunctionCatalyzes the deimination of arginine residues of proteins.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID5572747
UniProtKB IDQ9Y2J8
UniProtKB Entry NamePADI2_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0020605|Protein-arginine deiminase type-2 (PADI2)
ATGCTGCGCGAGCGGACCGTGCGGCTGCAGTACGGGAGCCGCGTGGAGGCGGTGTACGTG
CTGGGCACCTACCTCTGGACCGATGTCTACAGCGCGGCCCCAGCCGGGGCCCAAACCTTC
AGCCTGAAGCACTCGGAACACGTGTGGGTGGAGGTGGTGCGTGATGGGGAGGCTGAGGAG
GTGGCCACCAATGGCAAGCAGCGCTGGCTTCTCTCGCCCAGCACCACCCTGCGGGTCACC
ATGAGCCAGGCGAGCACCGAGGCCAGCAGTGACAAGGTCACCGTCAACTACTATGACGAG
GAAGGGAGCATTCCCATCGACCAGGCGGGGCTCTTCCTCACAGCCATTGAGATCTCCCTG
GATGTGGACGCAGACCGGGATGGTGTGGTGGAGAAGAACAACCCAAAGAAGGCATCCTGG
ACCTGGGGCCCCGAGGGCCAGGGGGCCATCCTGCTGGTGAACTGTGACCGAGAGACACCC
TGGTTGCCCAAGGAGGACTGCCGTGATGAGAAGGTCTACAGCAAGGAAGATCTCAAGGAC
ATGTCCCAGATGATCCTGCGGACCAAAGGCCCCGACCGCCTCCCCGCCGGATACGAGATA
GTTCTGTACATTTCCATGTCAGACTCAGACAAAGTGGGCGTGTTCTACGTGGAGAACCCG
TTCTTCGGCCAACGCTATATCCACATCCTGGGCCGGCGGAAGCTCTACCATGTGGTCAAG
TACACGGGTGGCTCCGCGGAGCTGCTGTTCTTCGTGGAAGGCCTCTGTTTCCCCGACGAG
GGCTTCTCAGGCCTGGTCTCCATCCATGTCAGCCTGCTGGAGTACATGGCCCAGGACATT
CCCCTGACTCCCATCTTCACGGACACCGTGATATTCCGGATTGCTCCGTGGATCATGACC
CCCAACATCCTGCCTCCCGTGTCGGTGTTTGTGTGCTGCATGAAGGATAATTACCTGTTC
CTGAAAGAGGTGAAGAACCTTGTGGAGAAAACCAACTGTGAGCTGAAGGTCTGCTTCCAG
TACCTAAACCGAGGCGATCGCTGGATCCAGGATGAAATTGAGTTTGGCTACATCGAGGCC
CCCCATAAAGGCTTCCCCGTGGTGCTGGACTCTCCCCGAGATGGAAACCTAAAGGACTTC
CCTGTGAAGGAGCTCCTGGGCCCAGATTTTGGCTACGTGACCCGGGAGCCCCTCTTTGAG
TCTGTCACCAGCCTTGACTCATTTGGAAACCTGGAGGTCAGTCCCCCAGTGACCGTGAAC
GGCAAGACATACCCGCTTGGCCGCATCCTCATCGGGAGCAGCTTTCCTCTGTCTGGTGGT
CGGAGGATGACCAAGGTGGTGCGTGACTTCCTGAAGGCCCAGCAGGTGCAGGCGCCCGTG
GAGCTCTACTCAGACTGGCTGACTGTGGGCCACGTGGATGAGTTCATGTCCTTTGTCCCC
ATCCCCGGCACAAAGAAATTCCTGCTACTCATGGCCAGCACCTCGGCCTGCTACAAGCTC
TTCCGAGAGAAGCAGAAGGACGGCCATGGAGAGGCCATCATGTTCAAAGGCTTGGGTGGG
ATGAGCAGCAAGCGAATCACCATCAACAAGATTCTGTCCAACGAGAGCCTTGTGCAGGAG
AACCTGTACTTCCAGCGCTGCCTAGACTGGAACCGTGACATCCTCAAGAAGGAGCTGGGA
CTGACAGAGCAGGACATCATTGACCTGCCCGCTCTGTTCAAGATGGACGAGGACCACCGT
GCCAGAGCCTTCTTCCCAAACATGGTGAACATGATCGTGCTGGACAAGGACCTGGGCATC
CCCAAGCCATTCGGGCCACAGGTTGAGGAGGAATGCTGCCTGGAGATGCACGTGCGTGGC
CTCCTGGAGCCCCTGGGCCTCGAATGCACCTTCATCGACGACATTTCTGCCTACCACAAA
TTTCTGGGGGAAGTCCACTGTGGCACCAACGTCCGCAGGAAGCCCTTCACCTTCAAGTGG
TGGCACATGGTGCCCTGA
GenBank Gene IDAB030176
GeneCard IDNot Available
GenAtlas IDPADI2
HGNC IDHGNC:18341
Chromosome Location1
Locus1p36.13
References
  1. Ishigami A, Ohsawa T, Asaga H, Akiyama K, Kuramoto M, Maruyama N: Human peptidylarginine deiminase type II: molecular cloning, gene organization, and expression in human skin. Arch Biochem Biophys. 2002 Nov 1;407(1):25-31. 12392711
  2. Chavanas S, Mechin MC, Takahara H, Kawada A, Nachat R, Serre G, Simon M: Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6. Gene. 2004 Apr 14;330:19-27. 15087120
  3. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. 10231032
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334