You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 22
Synonyms
  • 3.1.3.48
  • Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
  • Lymphoid phosphatase
  • LyP
  • PEP
  • PEST-domain phosphatase
  • PTPN8
Gene NamePTPN22
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009017|Tyrosine-protein phosphatase non-receptor type 22
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Number of residues807
Molecular Weight91703.92
Theoretical pINot Available
GO Classification
Functions
  • ubiquitin protein ligase binding
  • protein tyrosine phosphatase activity
  • phosphatase activity
  • SH3 domain binding
  • kinase binding
Processes
  • regulation of innate immune response
  • negative regulation of T cell receptor signaling pathway
  • lipopolysaccharide-mediated signaling pathway
  • cellular response to muramyl dipeptide
  • positive regulation of ERK1 and ERK2 cascade
  • negative regulation of interleukin-6 secretion
  • positive regulation of gene expression
  • negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
  • negative regulation of gene expression
  • negative regulation of p38MAPK cascade
  • protein dephosphorylation
  • negative regulation of T cell activation
  • negative regulation of interleukin-8 secretion
  • phosphoanandamide dephosphorylation
  • positive regulation of protein K63-linked ubiquitination
  • positive regulation of interferon-gamma secretion
  • positive regulation of toll-like receptor 3 signaling pathway
  • negative regulation of JUN kinase activity
  • positive regulation of toll-like receptor 4 signaling pathway
  • negative regulation of tumor necrosis factor production
  • regulation of B cell receptor signaling pathway
  • negative regulation of autophagy
  • regulation of natural killer cell proliferation
  • regulation of NIK/NF-kappaB signaling
  • peptidyl-tyrosine dephosphorylation
  • T cell differentiation
  • positive regulation of type I interferon production
  • autophagy
Components
  • cytoplasmic side of plasma membrane
  • cytoplasm
  • nucleus
  • perinuclear region of cytoplasm
General FunctionUbiquitin protein ligase binding
Specific FunctionActs as negative regulator of T-cell receptor (TCR) signaling by direct dephosphorylation of the Src family kinases LCK and FYN, ITAMs of the TCRz/CD3 complex, as well as ZAP70, VAV, VCP and other key signaling molecules (PubMed:16461343, PubMed:18056643). Associates with and probably dephosphorylates CBL. Dephosphorylates LCK at its activating 'Tyr-394' residue (PubMed:21719704). Dephosphorylates ZAP70 at its activating 'Tyr-493' residue (PubMed:16461343). Dephosphorylates the immune system activator SKAP2 (PubMed:21719704). Positively regulates toll-like receptor (TLR)-induced type 1 interferon production (PubMed:23871208). Promotes host antiviral responses mediated by type 1 interferon (By similarity). Regulates NOD2-induced pro-inflammatory cytokine secretion and autophagy (PubMed:23991106).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9Y2R2
UniProtKB Entry NamePTN22_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013565|Tyrosine-protein phosphatase non-receptor type 22 (PTPN22)
ATGGACCAAAGAGAAATTCTGCAGAAGTTCCTGGATGAGGCCCAAAGCAAGAAAATTACT
AAAGAGGAGTTTGCCAATGAATTTCTGAAGCTGAAAAGGCAATCTACCAAGTACAAGGCA
GACAAAACCTATCCTACAACTGTGGCTGAGAAGCCCAAGAATATCAAGAAAAACAGATAT
AAGGATATTTTGCCCTATGATTATAGCCGGGTAGAACTATCCCTGATAACCTCTGATGAG
GATTCCAGCTACATCAATGCCAACTTCATTAAGGGAGTTTATGGACCCAAGGCTTATATT
GCCACCCAGGGTCCTTTATCTACAACCCTCCTGGACTTCTGGAGGATGATTTGGGAATAT
AGTGTCCTTATCATTGTTATGGCATGCATGGAGTATGAAATGGGAAAGAAAAAGTGTGAG
CGCTACTGGGCTGAGCCAGGAGAGATGCAGCTGGAATTTGGCCCTTTCTCTGTATCCTGT
GAAGCTGAAAAAAGGAAATCTGATTATATAATCAGGACTCTAAAAGTTAAGTTCAATAGT
GAAACTCGAACTATCTACCAGTTTCATTACAAGAATTGGCCAGACCATGATGTACCTTCA
TCTATAGACCCTATTCTTGAGCTCATCTGGGATGTACGTTGTTACCAAGAGGATGACAGT
GTTCCCATATGCATTCACTGCAGTGCTGGCTGTGGAAGGACTGGTGTTATTTGTGCTATT
GATTATACATGGATGTTGCTAAAAGATGGGATAATTCCTGAGAACTTCAGTGTTTTCAGT
TTGATCCGGGAAATGCGGACACAGAGGCCTTCATTAGTTCAAACGCAGGAACAATATGAA
CTGGTCTACAATGCTGTATTAGAACTATTTAAGAGACAGATGGATGTTATCAGAGATAAA
CATTCTGGAACAGAGAGTCAAGCAAAGCATTGTATTCCTGAGAAAAATCACACTCTCCAA
GCAGACTCTTATTCTCCTAATTTACCAAAAAGTACCACAAAAGCAGCAAAAATGATGAAC
CAACAAAGGACAAAAATGGAAATCAAAGAATCTTCTTCCTTTGACTTTAGGACTTCTGAA
ATAAGTGCAAAAGAAGAGCTAGTTTTGCACCCTGCTAAATCAAGCACTTCTTTTGACTTT
CTGGAGCTAAATTACAGTTTTGACAAAAATGCTGACACAACCATGAAATGGCAGACAAAG
GCATTTCCAATAGTTGGGGAGCCTCTTCAGAAGCATCAAAGTTTGGATTTGGGCTCTCTT
TTGTTTGAGGGATGTTCTAATTCTAAACCTGTAAATGCAGCAGGAAGATATTTTAATTCA
AAGGTGCCAATAACACGGACCAAATCAACTCCTTTTGAATTGATACAGCAGAGAGAAACC
AAGGAGGTGGACAGCAAGGAAAACTTTTCTTATTTGGAATCTCAACCACATGATTCTTGT
TTTGTAGAGATGCAGGCTCAAAAAGTAATGCATGTTTCTTCAGCAGAACTGAATTATTCA
CTGCCATATGACTCTAAACACCAAATACGTAATGCCTCTAATGTAAAGCACCATGACTCT
AGTGCTCTTGGTGTATATTCTTACATACCTTTAGTGGAAAATCCTTATTTTTCATCATGG
CCTCCAAGTGGTACCAGTTCTAAGATGTCTCTTGATTTACCTGAGAAGCAAGATGGAACT
GTTTTTCCTTCTTCTCTGTTGCCAACATCCTCTACATCCCTCTTCTCTTATTACAATTCA
CATGATTCTTTATCACTGAATTCTCCAACCAATATTTCCTCACTATTGAACCAGGAGTCA
GCTGTACTAGCAACTGCTCCAAGGATAGATGATGAAATCCCCCCTCCACTTCCTGTACGG
ACACCTGAATCATTTATTGTGGTTGAGGAAGCTGGAGAATTCTCACCAAATGTTCCCAAA
TCCTTATCCTCAGCTGTGAAGAGTGTAAAACTCCGAAGTCCTAAATCAGAACTACATCAA
GATCGTTCTTCTCCCCCACCTCCTCTCCCAGAAAGAACTCTAGAGTCCTTCTTTCTTGCC
GATGAAGATTGTATGCAGGCCCAATCTATAGAAACATATTCTACTAGCTATCCTGACACC
ATGGAAAATTCAACATCTTCAAAACAGACACTGAAGACTCCTGGAAAAAGTTTCACAAGG
AGTAAGAGTTTGAAAATTTTGCGAAACATGAAAAAGAGTATCTGTAATTCTTGCCCACCA
AACAAGCCTGCAGAATCTGTTCAGTCAAATAACTCCAGCTCATTTCTGAATTTTGGTTTT
GCAAACCGTTTTTCAAAACCCAAAGGACCAAGGAATCCACCACCAACTTGGAATATTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9652
Chromosome Location1
LocusNot Available
References
  1. Cohen S, Dadi H, Shaoul E, Sharfe N, Roifman CM: Cloning and characterization of a lymphoid-specific, inducible human protein tyrosine phosphatase, Lyp. Blood. 1999 Mar 15;93(6):2013-24. 10068674
  2. Wang S, Dong H, Han J, Ho WT, Fu X, Zhao ZJ: Identification of a variant form of tyrosine phosphatase LYP. BMC Mol Biol. 2010 Nov 2;11:78. doi: 10.1186/1471-2199-11-78. 21044313
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Wu J, Katrekar A, Honigberg LA, Smith AM, Conn MT, Tang J, Jeffery D, Mortara K, Sampang J, Williams SR, Buggy J, Clark JM: Identification of substrates of human protein-tyrosine phosphatase PTPN22. J Biol Chem. 2006 Apr 21;281(16):11002-10. Epub 2006 Feb 6. 16461343
  7. Vang T, Miletic AV, Bottini N, Mustelin T: Protein tyrosine phosphatase PTPN22 in human autoimmunity. Autoimmunity. 2007 Sep;40(6):453-61. 17729039
  8. Chang HH, Tai TS, Lu B, Iannaccone C, Cernadas M, Weinblatt M, Shadick N, Miaw SC, Ho IC: PTPN22.6, a dominant negative isoform of PTPN22 and potential biomarker of rheumatoid arthritis. PLoS One. 2012;7(3):e33067. doi: 10.1371/journal.pone.0033067. Epub 2012 Mar 12. 22427951
  9. Wang Y, Shaked I, Stanford SM, Zhou W, Curtsinger JM, Mikulski Z, Shaheen ZR, Cheng G, Sawatzke K, Campbell AM, Auger JL, Bilgic H, Shoyama FM, Schmeling DO, Balfour HH Jr, Hasegawa K, Chan AC, Corbett JA, Binstadt BA, Mescher MF, Ley K, Bottini N, Peterson EJ: The autoimmunity-associated gene PTPN22 potentiates toll-like receptor-driven, type 1 interferon-dependent immunity. Immunity. 2013 Jul 25;39(1):111-22. doi: 10.1016/j.immuni.2013.06.013. Epub 2013 Jul 18. 23871208
  10. Spalinger MR, Lang S, Vavricka SR, Fried M, Rogler G, Scharl M: Protein tyrosine phosphatase non-receptor type 22 modulates NOD2-induced cytokine release and autophagy. PLoS One. 2013 Aug 26;8(8):e72384. doi: 10.1371/journal.pone.0072384. eCollection 2013. 23991106
  11. Yu X, Sun JP, He Y, Guo X, Liu S, Zhou B, Hudmon A, Zhang ZY: Structure, inhibitor, and regulatory mechanism of Lyp, a lymphoid-specific tyrosine phosphatase implicated in autoimmune diseases. Proc Natl Acad Sci U S A. 2007 Dec 11;104(50):19767-72. Epub 2007 Dec 3. 18056643
  12. Tsai SJ, Sen U, Zhao L, Greenleaf WB, Dasgupta J, Fiorillo E, Orru V, Bottini N, Chen XS: Crystal structure of the human lymphoid tyrosine phosphatase catalytic domain: insights into redox regulation . Biochemistry. 2009 Jun 9;48(22):4838-45. doi: 10.1021/bi900166y. 19371084
  13. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335
  14. Orru V, Tsai SJ, Rueda B, Fiorillo E, Stanford SM, Dasgupta J, Hartiala J, Zhao L, Ortego-Centeno N, D'Alfonso S, Arnett FC, Wu H, Gonzalez-Gay MA, Tsao BP, Pons-Estel B, Alarcon-Riquelme ME, He Y, Zhang ZY, Allayee H, Chen XS, Martin J, Bottini N: A loss-of-function variant of PTPN22 is associated with reduced risk of systemic lupus erythematosus. Hum Mol Genet. 2009 Feb 1;18(3):569-79. doi: 10.1093/hmg/ddn363. Epub 2008 Nov 3. 18981062
  15. Yu X, Chen M, Zhang S, Yu ZH, Sun JP, Wang L, Liu S, Imasaki T, Takagi Y, Zhang ZY: Substrate specificity of lymphoid-specific tyrosine phosphatase (Lyp) and identification of Src kinase-associated protein of 55 kDa homolog (SKAP-HOM) as a Lyp substrate. J Biol Chem. 2011 Sep 2;286(35):30526-34. doi: 10.1074/jbc.M111.254722. Epub 2011 Jun 30. 21719704
  16. Begovich AB, Carlton VE, Honigberg LA, Schrodi SJ, Chokkalingam AP, Alexander HC, Ardlie KG, Huang Q, Smith AM, Spoerke JM, Conn MT, Chang M, Chang SY, Saiki RK, Catanese JJ, Leong DU, Garcia VE, McAllister LB, Jeffery DA, Lee AT, Batliwalla F, Remmers E, Criswell LA, Seldin MF, Kastner DL, Amos CI, Sninsky JJ, Gregersen PK: A missense single-nucleotide polymorphism in a gene encoding a protein tyrosine phosphatase (PTPN22) is associated with rheumatoid arthritis. Am J Hum Genet. 2004 Aug;75(2):330-7. Epub 2004 Jun 18. 15208781
  17. Kyogoku C, Langefeld CD, Ortmann WA, Lee A, Selby S, Carlton VE, Chang M, Ramos P, Baechler EC, Batliwalla FM, Novitzke J, Williams AH, Gillett C, Rodine P, Graham RR, Ardlie KG, Gaffney PM, Moser KL, Petri M, Begovich AB, Gregersen PK, Behrens TW: Genetic association of the R620W polymorphism of protein tyrosine phosphatase PTPN22 with human SLE. Am J Hum Genet. 2004 Sep;75(3):504-7. Epub 2004 Jul 23. 15273934
  18. Bottini N, Musumeci L, Alonso A, Rahmouni S, Nika K, Rostamkhani M, MacMurray J, Meloni GF, Lucarelli P, Pellecchia M, Eisenbarth GS, Comings D, Mustelin T: A functional variant of lymphoid tyrosine phosphatase is associated with type I diabetes. Nat Genet. 2004 Apr;36(4):337-8. Epub 2004 Mar 7. 15004560
  19. Velaga MR, Wilson V, Jennings CE, Owen CJ, Herington S, Donaldson PT, Ball SG, James RA, Quinton R, Perros P, Pearce SH: The codon 620 tryptophan allele of the lymphoid tyrosine phosphatase (LYP) gene is a major determinant of Graves' disease. J Clin Endocrinol Metab. 2004 Nov;89(11):5862-5. 15531553
  20. Criswell LA, Pfeiffer KA, Lum RF, Gonzales B, Novitzke J, Kern M, Moser KL, Begovich AB, Carlton VE, Li W, Lee AT, Ortmann W, Behrens TW, Gregersen PK: Analysis of families in the multiple autoimmune disease genetics consortium (MADGC) collection: the PTPN22 620W allele associates with multiple autoimmune phenotypes. Am J Hum Genet. 2005 Apr;76(4):561-71. Epub 2005 Feb 17. 15719322
  21. Canton I, Akhtar S, Gavalas NG, Gawkrodger DJ, Blomhoff A, Watson PF, Weetman AP, Kemp EH: A single-nucleotide polymorphism in the gene encoding lymphoid protein tyrosine phosphatase (PTPN22) confers susceptibility to generalised vitiligo. Genes Immun. 2005 Oct;6(7):584-7. 16015369
  22. Arechiga AF, Habib T, He Y, Zhang X, Zhang ZY, Funk A, Buckner JH: Cutting edge: the PTPN22 allelic variant associated with autoimmunity impairs B cell signaling. J Immunol. 2009 Mar 15;182(6):3343-7. doi: 10.4049/jimmunol.0713370. 19265110
  23. Diaz-Gallo LM, Espino-Paisan L, Fransen K, Gomez-Garcia M, van Sommeren S, Cardena C, Rodrigo L, Mendoza JL, Taxonera C, Nieto A, Alcain G, Cueto I, Lopez-Nevot MA, Bottini N, Barclay ML, Crusius JB, van Bodegraven AA, Wijmenga C, Ponsioen CY, Gearry RB, Roberts RL, Weersma RK, Urcelay E, Merriman TR, Alizadeh BZ, Martin J: Differential association of two PTPN22 coding variants with Crohn's disease and ulcerative colitis. Inflamm Bowel Dis. 2011 Nov;17(11):2287-94. doi: 10.1002/ibd.21630. Epub 2011 Feb 1. 21287672
  24. Liu J, Chen M, Li R, Yang F, Shi X, Zhu L, Wang HM, Yao W, Liu Q, Meng FG, Sun JP, Pang Q, Yu X: Biochemical and functional studies of lymphoid-specific tyrosine phosphatase (Lyp) variants S201F and R266W. PLoS One. 2012;7(8):e43631. doi: 10.1371/journal.pone.0043631. Epub 2012 Aug 27. 22952725