You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameG-protein coupled receptor 55
SynonymsNot Available
Gene NameGPR55
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009829|G-protein coupled receptor 55
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Number of residues319
Molecular Weight36637.12
Theoretical pINot Available
GO Classification
Functions
  • G-protein coupled receptor activity
  • cannabinoid receptor activity
Processes
  • G-protein coupled receptor signaling pathway
  • cannabinoid signaling pathway
  • activation of phospholipase C activity
  • positive regulation of ERK1 and ERK2 cascade
  • negative regulation of osteoclast differentiation
  • bone resorption
  • positive regulation of Rho protein signal transduction
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionG-protein coupled receptor activity
Specific FunctionMay be involved in hyperalgesia associated with inflammatory and neuropathic pain (By similarity). Receptor for L-alpha-lysophosphatidylinositol (LPI). LPI induces Ca(2+) release from intracellular stores via the heterotrimeric G protein GNA13 and RHOA. Putative cannabinoid receptor. May play a role in bone physiology by regulating osteoclast number and function.
Pfam Domain Function
Transmembrane Regions22-42 59-79 95-115 138-158 181-201 232-252 272-292
GenBank Protein IDNot Available
UniProtKB IDQ9Y2T6
UniProtKB Entry NameGPR55_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013938|G-protein coupled receptor 55 (GPR55)
ATGAGTCAGCAAAACACCAGTGGGGACTGCCTGTTTGACGGTGTCAACGAGCTGATGAAA
ACCCTACAGTTTGCAGTCCACATCCCCACCTTCGTCCTGGGCCTGCTCCTCAACCTGCTG
GCCATCCATGGCTTCAGCACCTTCCTTAAGAACAGGTGGCCCGATTATGCTGCCACCTCC
ATCTACATGATCAACCTGGCAGTCTTTGACCTGCTGCTGGTGCTCTCCCTCCCATTCAAG
ATGGTCCTGTCCCAGGTACAGTCCCCCTTCCCGTCCCTGTGCACCCTGGTGGAGTGCCTT
TACTTCGTCAGCATGTACGGAAGCGTCTTCACCATCTGCTTCATCAGCATGGACCGGTTC
TTGGCCATCCGTTACCCGCTACTGGTGAGCCACCTCCGGTCCCCCAGGAAGATCTTTGGG
ATCTGCTGCACCATCTGGGTCCTGGTGTGGACCGGAAGCATCCCTATCTACAGTTTCCAT
GGGAAAGTGGAAAAATACATGTGCTTCCACAACATGTCTGATGATACCTGGAGCGCCAAG
GTCTTCTTCCCGCTGGAGGTGTTTGGCTTCCTCCTTCCCATGGGCATCATGGGCTTCTGC
TGCTCCAGGAGCATCCACATCCTGCTGGGCCGCCGAGACCACACCCAGGACTGGGTGCAG
CAGAAAGCCTGCATCTACAGCATCGCAGCCAGCCTGGCTGTCTTCGTGGTCTCCTTCCTC
CCAGTCCACCTGGGGTTCTTCCTGCAGTTCCTGGTGAGAAACAGCTTTATCGTAGAGTGC
AGAGCCAAGCAGAGCATCAGCTTCTTCTTGCAATTGTCCATGTGTTTCTCCAACGTCAAC
TGCTGCCTGGATGTTTTCTGCTACTACTTTGTCATCAAAGAATTCCGCATGAACATCAGG
GCCCACCGGCCTTCCAGGGTCCAGCTGGTCCTGCAGGACACCACGATCTCCCGGGGCTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4511
Chromosome Location2
LocusNot Available
References
  1. Sawzdargo M, Nguyen T, Lee DK, Lynch KR, Cheng R, Heng HH, George SR, O'Dowd BF: Identification and cloning of three novel human G protein-coupled receptor genes GPR52, PsiGPR53 and GPR55: GPR55 is extensively expressed in human brain. Brain Res Mol Brain Res. 1999 Feb 5;64(2):193-8. 9931487
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Oka S, Nakajima K, Yamashita A, Kishimoto S, Sugiura T: Identification of GPR55 as a lysophosphatidylinositol receptor. Biochem Biophys Res Commun. 2007 Nov 3;362(4):928-34. Epub 2007 Aug 24. 17765871
  4. Henstridge CM, Balenga NA, Ford LA, Ross RA, Waldhoer M, Irving AJ: The GPR55 ligand L-alpha-lysophosphatidylinositol promotes RhoA-dependent Ca2+ signaling and NFAT activation. FASEB J. 2009 Jan;23(1):183-93. doi: 10.1096/fj.08-108670. Epub 2008 Aug 29. 18757503
  5. Kapur A, Zhao P, Sharir H, Bai Y, Caron MG, Barak LS, Abood ME: Atypical responsiveness of the orphan receptor GPR55 to cannabinoid ligands. J Biol Chem. 2009 Oct 23;284(43):29817-27. doi: 10.1074/jbc.M109.050187. Epub 2009 Sep 1. 19723626
  6. Whyte LS, Ryberg E, Sims NA, Ridge SA, Mackie K, Greasley PJ, Ross RA, Rogers MJ: The putative cannabinoid receptor GPR55 affects osteoclast function in vitro and bone mass in vivo. Proc Natl Acad Sci U S A. 2009 Sep 22;106(38):16511-6. doi: 10.1073/pnas.0902743106. Epub 2009 Sep 3. 19805329