You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDual specificity tyrosine-phosphorylation-regulated kinase 1B
Synonyms
  • 2.7.12.1
  • Minibrain-related kinase
  • MIRK
  • Mirk protein kinase
Gene NameDYRK1B
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009304|Dual specificity tyrosine-phosphorylation-regulated kinase 1B
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Number of residues629
Molecular Weight69197.19
Theoretical pINot Available
GO Classification
Functions
  • protein serine/threonine/tyrosine kinase activity
  • ATP binding
  • protein kinase activity
  • protein serine/threonine kinase activity
  • transcription coactivator activity
  • protein tyrosine kinase activity
Processes
  • protein phosphorylation
  • myoblast fusion
  • adipose tissue development
  • positive regulation of transcription, DNA-templated
Components
  • nucleus
General FunctionTranscription coactivator activity
Specific FunctionDual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. Enhances the transcriptional activity of TCF1/HNF1A and FOXO1. Inhibits epithelial cell migration. Mediates colon carcinoma cell survival in mitogen-poor environments. Inhibits the SHH and WNT1 pathways, thereby enhancing adipogenesis. In addition, promotes expression of the gluconeogenic enzyme glucose-6-phosphatase (G6PC).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9Y463
UniProtKB Entry NameDYR1B_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0017744|Dual specificity tyrosine-phosphorylation-regulated kinase 1B (DYRK1B)
ATGGCCGTCCCACCGGGCCATGGTCCCTTCTCTGGCTTCCCAGGGCCCCAGGAGCACACG
CAGGTATTGCCTGATGTGCGGCTACTGCCTCGGAGGCTGCCCCTGGCCTTCCGGGATGCA
ACCTCAGCCCCGCTGCGTAAGCTCTCTGTGGACCTCATCAAGACCTACAAGCACATCAAT
GAGGTATACTATGCGAAGAAGAAGCGGCGGGCCCAGCAGGCGCCACCCCAGGATTCGAGC
AACAAGAAGGAGAAGAAGGTCCTGAACCATGGTTATGATGACGACAACCATGACTACATC
GTGCGCAGTGGCGAGCGCTGGCTGGAGCGCTACGAAATTGACTCGCTCATTGGCAAAGGC
TCCTTTGGCCAGGTGGTGAAAGCCTATGATCATCAGACCCAGGAGCTTGTGGCCATCAAG
ATCATCAAGAACAAAAAGGCTTTCCTGAACCAGGCCCAGATTGAGCTGCGGCTGCTGGAG
CTGATGAACCAGCATGACACGGAGATGAAGTACTATATAGTACACCTGAAGCGGCACTTC
ATGTTCCGGAACCACCTGTGCCTGGTATTTGAGCTGCTGTCCTACAACCTGTACGACCTC
CTGCGCAACACCCACTTCCGCGGCGTCTCGCTGAACCTGACCCGGAAGCTGGCGCAGCAG
CTCTGCACGGCACTGCTCTTTCTGGCCACGCCTGAGCTCAGCATCATTCACTGCGACCTC
AAGCCCGAAAACATCTTGCTGTGCAACCCCAAGCGCAGCGCCATCAAGATTGTGGACTTC
GGCAGCTCCTGCCAGCTTGGCCAGAGGATCTACCAGTATATCCAGAGCCGCTTCTACCGC
TCACCTGAGGTGCTCCTGGGCACACCCTACGACCTGGCCATTGACATGTGGTCCCTGGGC
TGCATCCTTGTGGAGATGCACACCGGAGAGCCCCTCTTCAGTGGCTCCAATGAGGTCGAC
CAGATGAACCGCATTGTGGAGGTGCTGGGCATCCCACCGGCCGCCATGCTGGACCAGGCG
CCCAAGGCTCGCAAGTACTTTGAACGGCTGCCTGGGGGTGGCTGGACCCTACGAAGGACG
AAAGAACTCAGGAAGGATTACCAGGGCCCCGGGACACGGCGGCTGCAGGAGGTGCTGGGC
GTGCAGACGGGCGGGCCCGGGGGCCGGCGGGCGGGGGAGCCGGGCCACAGCCCCGCCGAC
TACCTCCGCTTCCAGGACCTGGTGCTGCGCATGCTGGAGTATGAGCCCGCCGCCCGCATC
AGCCCCCTGGGGGCTCTGCAGCACGGCTTCTTCCGCCGCACGGCCGACGAGGCCACCAAC
ACGGGCCCGGCAGGCAGCAGTGCCTCCACCTCGCCCGCGCCCCTCGACACCTGCCCCTCT
TCCAGCACCGCCAGCTCCATCTCCAGTTCTGGAGGCTCCAGTGGCTCCTCCAGTGACAAC
CGGACCTACCGCTACAGCAACCGATATTGTGGGGGCCCTGGGCCCCCTATCACAGACTGT
GAGATGAACAGCCCCCAGGTCCCACCCTCCCAGCCGCTGCGGCCCTGGGCAGGGGGTGAT
GTGCCCCACAAGACACATCAAGCCCCTGCCTCTGCCTCGTCACTGCCTGGGACCGGGGCC
CAGTTACCCCCCCAGCCCCGATACCTTGGTCGTCCCCCATCACCAACCTCACCACCACCC
CCGGAGCTGATGGATGTGAGCCTGGTGGGCGGCCCTGCTGACTGCTCCCCACCTCACCCA
GCGCCTGCCCCCCAGCACCCGGCTGCCTCAGCCCTCCGGACTCGGATGACTGGAGGTCGT
CCACCCCTCCCGCCTCCTGATGACCCTGCCACTCTGGGGCCTCACCTGGGCCTCCGTGGT
GTACCCCAGAGCACAGCAGCCAGCTCGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:3092
Chromosome Location19
LocusNot Available
References
  1. Leder S, Weber Y, Altafaj X, Estivill X, Joost HG, Becker W: Cloning and characterization of DYRK1B, a novel member of the DYRK family of protein kinases. Biochem Biophys Res Commun. 1999 Jan 19;254(2):474-9. 9918863
  2. Lee K, Deng X, Friedman E: Mirk protein kinase is a mitogen-activated protein kinase substrate that mediates survival of colon cancer cells. Cancer Res. 2000 Jul 1;60(13):3631-7. 10910078
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Lim S, Jin K, Friedman E: Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. J Biol Chem. 2002 Jul 12;277(28):25040-6. Epub 2002 Apr 29. 11980910
  6. Zou Y, Lim S, Lee K, Deng X, Friedman E: Serine/threonine kinase Mirk/Dyrk1B is an inhibitor of epithelial cell migration and is negatively regulated by the Met adaptor Ran-binding protein M. J Biol Chem. 2003 Dec 5;278(49):49573-81. Epub 2003 Sep 18. 14500717
  7. Skurat AV, Dietrich AD: Phosphorylation of Ser640 in muscle glycogen synthase by DYRK family protein kinases. J Biol Chem. 2004 Jan 23;279(4):2490-8. Epub 2003 Oct 30. 14593110
  8. Tahtouh T, Elkins JM, Filippakopoulos P, Soundararajan M, Burgy G, Durieu E, Cochet C, Schmid RS, Lo DC, Delhommel F, Oberholzer AE, Pearl LH, Carreaux F, Bazureau JP, Knapp S, Meijer L: Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid leucettamine B. J Med Chem. 2012 Nov 8;55(21):9312-30. doi: 10.1021/jm301034u. Epub 2012 Oct 8. 22998443
  9. Keramati AR, Fathzadeh M, Go GW, Singh R, Choi M, Faramarzi S, Mane S, Kasaei M, Sarajzadeh-Fard K, Hwa J, Kidd KK, Babaee Bigi MA, Malekzadeh R, Hosseinian A, Babaei M, Lifton RP, Mani A: A form of the metabolic syndrome associated with mutations in DYRK1B. N Engl J Med. 2014 May 15;370(20):1909-19. doi: 10.1056/NEJMoa1301824. 24827035
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. 17344846