You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetal-response element-binding transcription factor 2
Synonyms
  • hPCl2
  • Metal regulatory transcription factor 2
  • Metal-response element DNA-binding protein M96
  • PCL2
  • Polycomb-like protein 2
Gene NameMTF2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009235|Metal-response element-binding transcription factor 2
MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGL
FYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMV
ICDKCGQGYHQLCHTPHIDCSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ
TLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLF
GDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENW
DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFK
AEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEP
LLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSR
KRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLAD
QELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Number of residues593
Molecular Weight67105.08
Theoretical pINot Available
GO Classification
Functions
  • methylated histone binding
  • zinc ion binding
  • DNA binding
Processes
  • negative regulation of gene expression, epigenetic
  • regulation of gene expression, epigenetic
  • negative regulation of histone H3-K27 methylation
  • positive regulation of histone H3-K27 methylation
  • segment specification
  • stem cell differentiation
  • gene expression
  • positive regulation of transcription from RNA polymerase II promoter
  • negative regulation of transcription from RNA polymerase II promoter
  • stem cell population maintenance
  • chromatin modification
Components
  • ESC/E(Z) complex
  • cytoplasm
  • nucleus
  • nucleoplasm
General FunctionZinc ion binding
Specific FunctionPolycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9Y483
UniProtKB Entry NameMTF2_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013687|Metal-response element-binding transcription factor 2 (MTF2)
ATGGTCTGTACAATATGTCAAGAAGAGTATTCAGAAGCTCCCAATGAAATGGTTATATGT
GACAAGTGTGGCCAAGGATATCATCAGTTGTGTCACACACCTCATATTGATTCCAGTGTG
ATTGATTCAGATGAAAAATGGCTCTGTCGGCAGTGTGTTTTTGCAACAACAACAAAGAGG
GGTGGTGCACTTAAGAAAGGACCAAATGCCAAAGCATTGCAAGTCATGAAGCAGACATTA
CCCTATAGTGTGGCAGACCTTGAATGGGATGCAGGTCATAAAACCAATGTCCAGCAGTGT
TACTGCTATTGTGGAGGCCCTGGAGACTGGTATTTGAAGATGCTACAGTGCTGCAAATGT
AAGCAGTGGTTTCATGAGGCTTGTGTGCAATGCCTTCAAAAGCCAATGCTATTTGGAGAC
AGATTTTATACGTTTATATGCTCTGTCTGCAGTTCTGGACCAGAATACCTCAAACGTCTA
CCATTACAGTGGGTAGATATAGCACACCTATGCCTTTACAACCTAAGTGTTATTCATAAG
AAGAAATACTTTGATTCTGAACTTGAGCTTATGACATACATTAATGAAAACTGGGATAGA
TTGCACCCTGGAGAGCTGGCAGACACACCAAAATCTGAAAGATATGAGCATGTTCTGGAG
GCATTAAATGATTACAAGACCATGTTTATGTCTGGGAAAGAAATAAAGAAGAAGAAGCAT
TTGTTTGGGTTGCGAATTCGTGTTCCTCCTGTGCCACCAAATGTGGCTTTCAAAGCAGAG
AAAGAACCTGAAGGAACATCTCATGAATTTAAAATTAAAGGCAGAAAGGCATCCAAACCT
ATATCTGATTCAAGGGAAGTAAGCAATGGCATAGAAAAAAAAGGAAAGAAAAAATCTGTA
GGTCGTCCACCTGGCCCATATACAAGAAAAATGATTCAAAAAACTGCTGAGCCACTTTTG
GATAAGGAATCAATTTCAGAGAATCCTACTTTGGATTTACCTTGTTCTATAGGGAGAACT
GAGGGAACTGCACATTCATCCAATACCTCAGATGTGGATTTCACGGGTGCTTCCAGTGCA
AAAGAAACTACCTCGTCTAGCATTTCCAGGCATTATGGATTATCTGACTCCAGAAAAAGA
ACGCGTACAGGAAGATCTTGGCCTGCTGCAATACCACATTTGCGGAGAAGAAGAGGTCGT
CTTCCAAGAAGAGCACTCCAGACTCAGAACTCAGAAATTGTAAAAGATGATGAAGGCAAA
GAAGATTATCAGTTTGATGAACTCAACACAGAGATTCTGAATAACTTAGCAGATCAGGAG
TTACAACTCAATCATCTAAAGAACTCCATTACCAGTTATTTTGGTGCTGCAGGTAGAATA
GCATGTGGCGAAAAATACCGAGTTTTGGCACGTCGGGTGACACTTGATGGAAAGGTGCAG
TATCTTGTGGAATGGGAAGGAGCAACTGCATCCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29535
Chromosome Location1
LocusNot Available
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  4. Musselman CA, Avvakumov N, Watanabe R, Abraham CG, Lalonde ME, Hong Z, Allen C, Roy S, Nunez JK, Nickoloff J, Kulesza CA, Yasui A, Cote J, Kutateladze TG: Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1. Nat Struct Mol Biol. 2012 Dec;19(12):1266-72. doi: 10.1038/nsmb.2435. Epub 2012 Nov 11. 23142980
  5. Qin S, Guo Y, Xu C, Bian C, Fu M, Gong S, Min J: Tudor domains of the PRC2 components PHF1 and PHF19 selectively bind to histone H3K36me3. Biochem Biophys Res Commun. 2013 Jan 11;430(2):547-53. doi: 10.1016/j.bbrc.2012.11.116. Epub 2012 Dec 7. 23228662