You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLysine-specific demethylase 3A
Synonyms
  • 1.14.11.-
  • JHDM2A
  • JmjC domain-containing histone demethylation protein 2A
  • JMJD1
  • JMJD1A
  • Jumonji domain-containing protein 1A
  • KIAA0742
  • TSGA
Gene NameKDM3A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008940|Lysine-specific demethylase 3A
MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLL
DKAGLGSITSVRFLGDQQRVFLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDE
SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIH
VEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEALRTK
PDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACR
SQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAI
GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDLKQTSLAGEKP
TLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
KNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
EQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
PADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
P
Number of residues1321
Molecular Weight147339.98
Theoretical pINot Available
GO Classification
Functions
  • transcription factor activity, sequence-specific DNA binding
  • androgen receptor binding
  • core promoter binding
  • transcription regulatory region sequence-specific DNA binding
  • iron ion binding
  • dioxygenase activity
Processes
  • formaldehyde biosynthetic process
  • histone H3-K9 demethylation
  • histone H3-K9 dimethylation
  • spermatid nucleus elongation
  • positive regulation of transcription, DNA-templated
  • positive regulation of transcription from RNA polymerase II promoter
  • transcription, DNA-templated
  • hormone-mediated signaling pathway
  • negative regulation of histone H3-K9 methylation
  • androgen receptor signaling pathway
  • chromatin organization
Components
  • cytoplasm
  • membrane
  • nucleus
  • nucleoplasm
General FunctionTranscription regulatory region sequence-specific dna binding
Specific FunctionHistone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Preferentially demethylates mono- and dimethylated H3 'Lys-9' residue, with a preference for dimethylated residue, while it has weak or no activity on trimethylated H3 'Lys-9'. Demethylation of Lys residue generates formaldehyde and succinate. Involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes, resulting in H3 'Lys-9' demethylation and transcriptional activation. Involved in spermatogenesis by regulating expression of target genes such as PRM1 and TMP1 which are required for packaging and condensation of sperm chromatin. Involved in obesity resistance through regulation of metabolic genes such as PPARA and UCP1.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9Y4C1
UniProtKB Entry NameKDM3A_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013520|Lysine-specific demethylase 3A (KDM3A)
ATGGTGCTCACGCTCGGAGAAAGTTGGCCGGTATTGGTGGGGAGGAGGTTTCTCAGTCTG
TCCGCAGCCGACGGCAGCGATGGCAGCCACGACAGCTGGGACGTGGAGCGCGTCGCCGAG
TGGCCCTGGCTCTCCGGGACCATTCGAGCTGTTTCCCACACCGACGTTACCAAGAAGGAT
CTGAAGGTGTGTGTGGAATTTGATGGGGAATCTTGGAGGAAAAGAAGATGGATAGAAGTC
TACAGCCTTCTAAGGAGAGCATTTTTAGTAGAACATAATTTGGTTTTAGCTGAACGAAAG
TCACCTGAAATTTCTGAACGAATTGTACAGTGGCCTGCAATAACGTACAAACCTCTGTTG
GACAAAGCTGGTTTGGGATCCATAACTTCTGTTCGCTTTCTGGGAGATCAACAAAGAGTA
TTTCTTTCTAAAGACCTTTTGAAGCCTATACAGGATGTAAACAGTCTTCGACTTTCTCTT
ACGGATAATCAGATTGTCAGTAAAGAATTTCAAGCTTTGATTGTGAAGCATTTAGATGAA
AGCCATCTTTTAAAAGGTGACAAAAACTTAGTTGGTTCAGAAGTAAAAATTTATAGCTTG
GACCCATCTACTCAGTGGTTTTCAGCAACCGTTATAAATGGAAACCCAGCATCAAAAACT
CTTCAAGTCAACTGTGAGGAGATTCCAGCACTGAAAATTGTTGATCCGTCACTGATTCAT
GTTGAAGTTGTACACGATAACCTTGTGACATGTGGTAATTCTGCAAGAATTGGAGCTGTA
AAACGCAAGTCTTCTGAGAATAATGGAACCCTGGTTTCCAAACAAGCAAAATCTTGCTCT
GAGGCCTCTCCCAGTATGTGTCCTGTGCAGTCTGTACCTACAACAGTTTTTAAGGAGATA
CTGCTTGGCTGTACTGCGGCAACTCCACCTAGTAAGGACCCAAGACAGCAAAGTACTCCC
CAGGCTGCCAACTCTCCACCTAACCTTGGAGCAAAAATTCCTCAAGGATGTCATAAACAA
AGTTTACCAGAGGAAATTTCTTCCTGTCTAAATACAAAGTCTGAAGCTCTGAGAACAAAA
CCAGATGTCTGCAAAGCAGGGTTGCTCTCAAAGTCCTCTCAGATTGGAACTGGAGACTTG
AAAATTCTGACTGAGCCAAAAGGCAGCTGTACTCAGCCTAAGACAAACACTGATCAGGAA
AACAGATTGGAGTCTGTTCCACAAGCATTGACTGGCCTTCCTAAGGAGTGCTTACCTACA
AAGGCTTCTTCTAAGGCAGAATTGGAAATTGCCAATCCTCCTGAACTGCAGAAGCACCTA
GAACATGCACCTTCCCCATCGGATGTTTCAAATGCACCAGAAGTGAAAGCAGGTGTCAAT
AGTGATAGCCCTAATAACTGTTCAGGAAAAAAGGTAGAACCTTCAGCTTTAGCTTGCCGA
TCACAGAATTTAAAGGAATCTTCAGTAAAAGTAGATAATGAAAGCTGTTGTTCAAGAAGC
AACAATAAAATCCAGAATGCCCCATCCAGGAAGTCGGTTTTGACAGACCCAGCTAAACTC
AAAAAGCTGCAACAGAGTGGCGAGGCCTTCGTACAGGATGATTCTTGTGTGAACATCGTG
GCACAGTTGCCTAAATGCCGAGAGTGTCGCTTGGACAGTCTCCGCAAGGATAAGGAGCAA
CAGAAGGACTCACCTGTGTTTTGCCGCTTCTTTCACTTCAGGAGGTTACAATTCAACAAA
CATGGTGTGTTGCGGGTAGAAGGCTTCTTAACACCAAACAAGTATGACAATGAAGCAATT
GGCTTGTGGTTACCTTTAACCAAAAACGTTGTGGGGATTGATTTGGACACAGCAAAGTAC
ATCTTGGCCAACATTGGAGACCACTTCTGTCAAATGGTGATTTCTGAAAAGGAAGCTATG
TCAACTATTGAGCCACACAGACAGGTTGCTTGGAAGCGAGCTGTCAAAGGTGTTCGAGAA
ATGTGTGATGTGTGCGACACCACCATCTTCAACCTGCACTGGGTGTGTCCTCGGTGTGGG
TTTGGAGTATGTGTGGACTGCTACCGGATGAAGAGAAAGAATTGCCAACAGGGTGCTGCT
TACAAGACTTTCTCTTGGCTAAAATGTGTGAAGAGTCAGATACATGAACCAGAGAACTTA
ATGCCCACACAGATCATTCCTGGAAAAGCACTCTATGATGTTGGAGACATTGTTCATTCT
GTAAGAGCGAAATGGGGAATAAAGGCAAACTGCCCTTGTTCAAACAGGCAATTCAAACTC
TTTTCAAAGCCAGCCTCAAAGGAAGACCTAAAACAGACTTCTTTAGCTGGAGAAAAACCG
ACTCTTGGTGCAGTGCTCCAGCAGAATCCCTCAGTGTTGGAGCCAGCAGCTGTGGGTGGG
GAAGCAGCCTCCAAGCCAGCCGGCAGCATGAAGCCTGCCTGTCCAGCCAGCACATCTCCT
CTAAACTGGCTGGCCGACCTAACCAGCGGGAATGTCAACAAGGAAAACAAGGAAAAACAA
CCAACAATGCCAATTTTAAAGAATGAAATCAAATGCCTTCCACCCCTCCCACCTTTAAGC
AAATCCAGCACAGTCCTCCATACGTTTAACAGCACAATTTTGACACCCGTAAGCAACAAC
AATTCTGGTTTCCTCCGGAATCTCTTGAATTCTTCTACAGGAAAGACAGAAAATGGACTC
AAGAATACACCAAAAATCCTTGATGACATCTTTGCCTCTTTGGTGCAAAATAAGACGACT
TCTGATTTATCTAAGAGGCCTCAAGGACTAACCATCAAGCCCAGCATTCTGGGCTTTGAC
ACTCCTCACTATTGGCTTTGTGATAATCGCTTGCTGTGCTTGCAAGACCCCAACAATAAG
AGCAACTGGAATGTGTTTAGGGAGTGCTGGAAACAAGGGCAGCCAGTGATGGTGTCTGGA
GTGCATCATAAATTGAACTCTGAACTTTGGAAACCTGAATCCTTCAGGAAAGAGTTTGGT
GAGCAGGAAGTAGACCTAGTTAATTGTAGGACCAATGAAATCATCACAGGAGCCACAGTA
GGAGACTTCTGGGATGGATTTGAAGATGTTCCAAATCGTTTGAAAAATGAAAAAGAACCA
ATGGTGTTGAAACTTAAGGACTGGCCACCAGGAGAAGATTTTAGAGATATGATGCCTTCC
AGGTTTGATGATCTGATGGCCAACATTCCACTGCCCGAGTACACAAGGCGAGATGGCAAA
CTGAATTTGGCCTCTAGGCTGCCAAACTACTTTGTTCGGCCAGATCTGGGCCCCAAGATG
TATAATGCTTATGGATTAATCACTCCTGAAGATCGGAAATATGGAACAACAAATCTTCAC
TTAGATGTATCTGATGCAGCTAATGTCATGGTCTATGTGGGAATTCCCAAAGGACAGTGT
GAGCAAGAAGAAGAAGTCCTTAAGACCATCCAAGATGGAGATTCTGACGAACTCACAATA
AAGCGATTTATTGAAGGAAAAGAGAAGCCAGGAGCACTGTGGCACATATATGCTGCAAAG
GACACGGAGAAGATAAGGGAATTTCTTAAAAAGGTATCAGAAGAGCAAGGTCAAGAAAAC
CCAGCAGACCACGATCCTATTCATGATCAAAGCTGGTATTTAGACCGATCATTAAGAAAA
CGTCTTCATCAAGAGTATGGAGTTCAAGGCTGGGCTATTGTACAGTTTCTTGGGGATGTG
GTGTTTATCCCGGCAGGAGCTCCACATCAGGTTCATAACTTATATAGCTGCATCAAAGTG
GCTGAAGATTTTGTTTCTCCAGAGCATGTTAAACACTGCTTCTGGCTTACTCAGGAATTC
CGATATCTGTCACAGACTCATACCAATCACGAAGATAAATTACAGGTGAAGAATGTTATC
TACCATGCAGTGAAAGATGCAGTTGCTATGCTGAAAGCCAGTGAATCCAGTTTTGGCAAA
CCTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:20815
Chromosome Location2
LocusNot Available
References
  1. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. 9872452
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  4. Yamane K, Toumazou C, Tsukada Y, Erdjument-Bromage H, Tempst P, Wong J, Zhang Y: JHDM2A, a JmjC-containing H3K9 demethylase, facilitates transcription activation by androgen receptor. Cell. 2006 May 5;125(3):483-95. Epub 2006 Apr 6. 16603237
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  6. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  7. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  8. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974