You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCarboxypeptidase Q
Synonyms
  • 3.4.17.-
  • LCH1
  • Lysosomal dipeptidase
  • PGCP
  • Plasma glutamate carboxypeptidase
Gene NameCPQ
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009559|Carboxypeptidase Q
MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQ
NRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA
VMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINY
SRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAE
MMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGA
MDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLV
MESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA
SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS
Number of residues472
Molecular Weight51887.185
Theoretical pINot Available
GO Classification
Functions
  • metallodipeptidase activity
  • carboxypeptidase activity
  • metal ion binding
  • protein homodimerization activity
Processes
  • proteolysis
  • tissue regeneration
  • thyroid hormone generation
  • peptide catabolic process
Components
  • cytoplasm
  • endoplasmic reticulum
  • extracellular space
  • lysosome
  • Golgi apparatus
  • extracellular exosome
General FunctionProtein homodimerization activity
Specific FunctionCarboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9Y646
UniProtKB Entry NameCBPQ_HUMAN
Cellular LocationEndoplasmic reticulum
Gene sequence
>lcl|BSEQ0013236|Carboxypeptidase Q (CPQ)
ATGAAATTCCTTATCTTCGCATTTTTCGGTGGTGTTCACCTTTTATCCCTGTGCTCTGGG
AAAGCTATATGCAAGAATGGCATCTCTAAGAGGACTTTTGAAGAAATAAAAGAAGAAATA
GCCAGCTGTGGAGATGTTGCTAAAGCAATCATCAACCTAGCTGTTTATGGTAAAGCCCAG
AACAGATCCTATGAGCGATTGGCACTTCTGGTTGATACTGTTGGACCCAGACTGAGTGGC
TCCAAGAACCTAGAAAAAGCCATCCAAATTATGTACCAAAACCTGCAGCAAGATGGGCTG
GAGAAAGTTCACCTGGAGCCAGTGAGAATACCCCACTGGGAGAGGGGAGAAGAATCAGCT
GTGATGCTGGAGCCAAGAATTCATAAGATAGCCATCCTGGGTCTTGGCAGCAGCATTGGG
ACTCCTCCAGAAGGCATTACAGCAGAAGTTCTGGTGGTGACCTCTTTCGATGAACTGCAG
AGAAGGGCCTCAGAAGCAAGAGGGAAGATTGTTGTTTATAACCAACCTTACATCAACTAC
TCAAGGACGGTGCAATACCGAACGCAGGGGGCGGTGGAAGCTGCCAAGGTGGGGGCTTTG
GCATCTCTCATTCGATCCGTGGCCTCCTTCTCCATCTACAGTCCTCACACAGGTATTCAG
GAATACCAGGATGGCGTGCCCAAGATTCCAACAGCCTGTATTACGGTGGAAGATGCAGAA
ATGATGTCAAGAATGGCTTCTCATGGGATCAAAATTGTCATTCAGCTAAAGATGGGGGCA
AAGACCTACCCAGATACTGATTCCTTCAACACTGTAGCAGAGATCACTGGGAGCAAATAT
CCAGAACAGGTTGTACTGGTCAGTGGACATCTGGACAGCTGGGATGTTGGGCAGGGTGCC
ATGGATGATGGCGGTGGAGCCTTTATATCATGGGAAGCACTCTCACTTATTAAAGATCTT
GGGCTGCGTCCAAAGAGGACTCTGCGGCTGGTGCTCTGGACTGCAGAAGAACAAGGTGGA
GTTGGTGCCTTCCAGTATTATCAGTTACACAAGGTAAATATTTCCAACTACAGTCTGGTG
ATGGAGTCTGACGCAGGAACCTTCTTACCCACTGGGCTGCAATTCACTGGCAGTGAAAAG
GCCAGGGCCATCATGGAGGAGGTTATGAGCCTGCTGCAGCCCCTCAATATCACTCAGGTC
CTGAGCCATGGAGAAGGGACAGACATCAACTTTTGGATCCAAGCTGGAGTGCCTGGAGCC
AGTCTACTTGATGACTTATACAAGTATTTCTTCTTCCATCACTCCCACGGAGACACCATG
ACTGTCATGGATCCAAAGCAGATGAATGTTGCTGCTGCTGTTTGGGCTGTTGTTTCTTAT
GTTGTTGCAGACATGGAAGAAATGCTGCCTAGGTCCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:16910
Chromosome Location8
LocusNot Available
References
  1. Gingras R, Richard C, El-Alfy M, Morales CR, Potier M, Pshezhetsky AV: Purification, cDNA cloning, and expression of a new human blood plasma glutamate carboxypeptidase homologous to N-acetyl-aspartyl-alpha-glutamate carboxypeptidase/prostate-specific membrane antigen. J Biol Chem. 1999 Apr 23;274(17):11742-50. 10206990
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. 16303743
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Dolenc I, Mihelic M: Purification and primary structure determination of human lysosomal dipeptidase. Biol Chem. 2003 Feb;384(2):317-20. 12675526
  6. Smith MW, Yue ZN, Geiss GK, Sadovnikova NY, Carter VS, Boix L, Lazaro CA, Rosenberg GB, Bumgarner RE, Fausto N, Bruix J, Katze MG: Identification of novel tumor markers in hepatitis C virus-associated hepatocellular carcinoma. Cancer Res. 2003 Feb 15;63(4):859-64. 12591738
  7. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  8. Dolenc I, Pain R, Turk V: Presence of the propeptide on recombinant lysosomal dipeptidase controls both activation and dimerization. Biol Chem. 2007 Jan;388(1):47-51. 17214548
  9. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218