You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent calcium channel gamma-2 subunit
Synonyms
  • Neuronal voltage-gated calcium channel gamma-2 subunit
  • TARP gamma-2
  • Transmembrane AMPAR regulatory protein gamma-2
Gene NameCACNG2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013466|Voltage-dependent calcium channel gamma-2 subunit
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV
Number of residues323
Molecular Weight35965.44
Theoretical pINot Available
GO Classification
Functions
  • voltage-gated calcium channel activity
  • channel regulator activity
Processes
  • transmission of nerve impulse
  • synaptic transmission
  • calcium ion transmembrane transport
  • neuromuscular junction development
  • membrane depolarization
  • membrane hyperpolarization
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity
  • transport
Components
  • voltage-gated calcium channel complex
  • plasma membrane
  • endocytic vesicle membrane
  • AMPA glutamate receptor complex
General FunctionVoltage-gated calcium channel activity
Specific FunctionRegulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Pfam Domain Function
Transmembrane Regions10-30 104-124 134-154 182-202
GenBank Protein IDNot Available
UniProtKB IDQ9Y698
UniProtKB Entry NameCCG2_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013467|Voltage-dependent calcium channel gamma-2 subunit (CACNG2)
ATGGGGCTGTTTGATCGAGGTGTTCAAATGCTTTTAACCACCGTTGGTGCTTTCGCTGCC
TTCAGCCTGATGACCATAGCTGTGGGAACCGACTATTGGCTCTACTCCAGAGGGGTTTGC
AAGACCAAAAGTGTCAGTGAGAATGAAACCAGCAAAAAGAACGAGGAAGTTATGACCCAT
TCCGGATTATGGAGAACCTGCTGCCTAGAAGGGAATTTCAAAGGTCTGTGCAAGCAAATT
GATCACTTCCCAGAGGATGCAGATTACGAAGCTGACACAGCAGAATATTTCCTCCGGGCC
GTGAGGGCCTCCAGCATTTTCCCAATCCTGAGTGTGATTCTGCTTTTCATGGGTGGCCTC
TGCATCGCAGCCAGCGAGTTCTACAAAACTCGACACAACATCATCCTGAGTGCCGGCATC
TTCTTCGTGTCTGCAGGTCTGAGTAACATCATTGGCATCATAGTGTACATATCTGCCAAT
GCCGGAGACCCCTCCAAGAGCGACTCCAAAAAGAATAGTTACTCATACGGCTGGTCCTTC
TACTTCGGGGCCCTGTCCTTCATCATCGCCGAGATGGTCGGGGTGCTGGCGGTGCACATG
TTTATCGACCGGCACAAACAGCTGCGGGCCACGGCCCGCGCCACGGACTACCTCCAGGCC
TCTGCCATCACCCGCATCCCCAGCTACCGCTACCGCTACCAGCGCCGCAGCCGCTCCAGC
TCGCGCTCCACGGAGCCCTCACACTCCAGGGACGCCTCCCCCGTGGGCATCAAGGGCTTC
AACACCCTGCCGTCCACGGAGATCTCCATGTACACGCTCAGCAGGGACCCCCTGAAGGCC
GCCACCACGCCCACCGCCACCTACAACTCCGACAGGGATAACAGCTTCCTCCAGGTTCAC
AACTGTATCCAGAAGGAGAACAAGGACTCTCTCCACTCCAACACAGCCAACCGCCGGACC
ACCCCCGTATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1406
Chromosome Location22
LocusNot Available
References
  1. Black JL 3rd, Lennon VA: Identification and cloning of putative human neuronal voltage-gated calcium channel gamma-2 and gamma-3 subunits: neurologic implications. Mayo Clin Proc. 1999 Apr;74(4):357-61. 10221464
  2. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Shi Y, Suh YH, Milstein AD, Isozaki K, Schmid SM, Roche KW, Nicoll RA: Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proc Natl Acad Sci U S A. 2010 Sep 14;107(37):16315-9. doi: 10.1073/pnas.1011706107. Epub 2010 Aug 30. 20805473
  6. Hamdan FF, Gauthier J, Araki Y, Lin DT, Yoshizawa Y, Higashi K, Park AR, Spiegelman D, Dobrzeniecka S, Piton A, Tomitori H, Daoud H, Massicotte C, Henrion E, Diallo O, Shekarabi M, Marineau C, Shevell M, Maranda B, Mitchell G, Nadeau A, D'Anjou G, Vanasse M, Srour M, Lafreniere RG, Drapeau P, Lacaille JC, Kim E, Lee JR, Igarashi K, Huganir RL, Rouleau GA, Michaud JL: Excess of de novo deleterious mutations in genes associated with glutamatergic systems in nonsyndromic intellectual disability. Am J Hum Genet. 2011 Mar 11;88(3):306-16. doi: 10.1016/j.ajhg.2011.02.001. Epub 2011 Mar 3. 21376300