NameInterferon beta
Synonyms
  • Fibroblast interferon
  • IFB
  • IFN-beta
  • IFNB
Gene NameIFNB1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010650|Interferon beta
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
Number of residues187
Molecular Weight22293.68
Theoretical pI8.91
GO Classification
Functions
  • cytokine activity
  • chloramphenicol O-acetyltransferase activity
  • type I interferon receptor binding
Processes
  • B cell activation involved in immune response
  • positive regulation of transcription from RNA polymerase II promoter
  • cellular response to exogenous dsRNA
  • cell surface receptor signaling pathway
  • cellular response to virus
  • defense response to bacterium
  • defense response to virus
  • B cell proliferation
  • natural killer cell activation involved in immune response
  • cytokine-mediated signaling pathway
  • negative regulation of T cell differentiation
  • cellular response to dexamethasone stimulus
  • negative regulation of T-helper 2 cell cytokine production
  • positive regulation of apoptotic signaling pathway
  • negative regulation of viral genome replication
  • regulation of type I interferon-mediated signaling pathway
  • response to virus
  • positive regulation of innate immune response
  • type I interferon signaling pathway
  • blood coagulation
  • positive regulation of peptidyl-serine phosphorylation of STAT protein
  • adaptive immune response
  • regulation of MHC class I biosynthetic process
  • cellular response to interferon-beta
  • T cell activation involved in immune response
  • B cell differentiation
  • natural killer cell activation
  • humoral immune response
  • response to exogenous dsRNA
  • innate immune response
Components
  • extracellular region
  • extracellular space
General FunctionType i interferon receptor binding
Specific FunctionHas antiviral, antibacterial and anticancer activities.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID32638
UniProtKB IDP01574
UniProtKB Entry NameIFNB_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0010651|Interferon beta (IFNB1)
ATGACCAACAAGTGTCTCCTCCAAATTGCTCTCCTGTTGTGCTTCTCCACTACAGCTCTT
TCCATGAGCTACAACTTGCTTGGATTCCTACAAAGAAGCAGCAATTTTCAGTGTCAGAAG
CTCCTGTGGCAATTGAATGGGAGGCTTGAATACTGCCTCAAGGACAGGATGAACTTTGAC
ATCCCTGAGGAGATTAAGCAGCTGCAGCAGTTCCAGAAGGAGGACGCCGCATTGACCATC
TATGAGATGCTCCAGAACATCTTTGCTATTTTCAGACAAGATTCATCTAGCACTGGCTGG
AATGAGACTATTGTTGAGAACCTCCTGGCTAATGTCTATCATCAGATAAACCATCTGAAG
ACAGTCCTGGAAGAAAAACTGGAGAAAGAAGATTTCACCAGGGGAAAACTCATGAGCAGT
CTGCACCTGAAAAGATATTATGGGAGGATTCTGCATTACCTGAAGGCCAAGGAGTACAGT
CACTGTGCCTGGACCATAGTCAGAGTGGAAATCCTAAGGAACTTTTACTTCATTAACAGA
CTTACAGGTTACCTCCGAAACTGA
GenBank Gene IDV00534
GeneCard IDNot Available
GenAtlas IDIFNB1
HGNC IDHGNC:5434
Chromosome Location9
Locus9p21
References
  1. Lawn RM, Adelman J, Franke AE, Houck CM, Gross M, Najarian R, Goeddel DV: Human fibroblast interferon gene lacks introns. Nucleic Acids Res. 1981 Mar 11;9(5):1045-52. 6164984
  2. Ohno S, Taniguchi T: Structure of a chromosomal gene for human interferon beta. Proc Natl Acad Sci U S A. 1981 Sep;78(9):5305-9. 16593086
  3. Taniguchi T, Ohno S, Fujii-Kuriyama Y, Muramatsu M: The nucleotide sequence of human fibroblast interferon cDNA. Gene. 1980 Jun;10(1):11-5. 6157601
  4. Derynck R, Content J, DeClercq E, Volckaert G, Tavernier J, Devos R, Fiers W: Isolation and structure of a human fibroblast interferon gene. Nature. 1980 Jun 19;285(5766):542-7. 6157094
  5. Houghton M, Easton MA, Stewart AG, Smith JC, Doel SM, Catlin GH, Lewis HM, Patel TP, Emtage JS, Carey NH, Porter AG: The complete amino acid sequence of human fibroblast interferon as deduced using synthetic oligodeoxyribonucleotide primers of reverse transcriptase. Nucleic Acids Res. 1980 Jul 11;8(13):2885-94. 6159580
  6. Goeddel DV, Shepard HM, Yelverton E, Leung D, Crea R, Sloma A, Pestka S: Synthesis of human fibroblast interferon by E. coli. Nucleic Acids Res. 1980 Sep 25;8(18):4057-74. 6159584
  7. May LT, Sehgal PB: On the relationship between human interferon alpha 1 and beta 1 genes. J Interferon Res. 1985 Summer;5(3):521-6. 2414376
  8. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. 19054851
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  10. Houghton M, Stewart AG, Doel SM, Emtage JS, Eaton MA, Smith JC, Patel TP, Lewis HM, Porter AG, Birch JR, Cartwright T, Carey NH: The amino-terminal sequence of human fibroblast interferon as deduced from reverse transcripts obtained using synthetic oligonucleotide primers. Nucleic Acids Res. 1980 May 10;8(9):1913-31. 6159597
  11. Wetzel R: Assignment of the disulphide bonds of leukocyte interferon. Nature. 1981 Feb 12;289(5798):606-7. 6162107
  12. Shepard HM, Leung D, Stebbing N, Goeddel DV: A single amino acid change in IFN-beta1 abolishes its antiviral activity. Nature. 1981 Dec 10;294(5841):563-5. 6171735
  13. Karpusas M, Nolte M, Benton CB, Meier W, Lipscomb WN, Goelz S: The crystal structure of human interferon beta at 2.2-A resolution. Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11813-8. 9342320
  14. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974