NameIg epsilon chain C region
SynonymsNot Available
Gene NameIGHE
OrganismHuman
Amino acid sequence
>lcl|BSEQ0005613|Ig epsilon chain C region
ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTL
TLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSS
CDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTL
SQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCL
VVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCR
VTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWL
HNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR
AVSVNPGK
Number of residues428
Molecular Weight47018.665
Theoretical pI8.13
GO Classification
Functions
  • antigen binding
  • immunoglobulin receptor binding
Processes
  • B cell receptor signaling pathway
  • complement activation, classical pathway
  • phagocytosis, recognition
  • positive regulation of B cell activation
  • immune response
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
  • Fc-epsilon receptor signaling pathway
  • receptor-mediated endocytosis
  • defense response to bacterium
  • phagocytosis, engulfment
Components
  • immunoglobulin complex, circulating
  • extracellular region
  • external side of plasma membrane
  • blood microparticle
General FunctionImmunoglobulin receptor binding
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP01854
UniProtKB Entry NameIGHE_HUMAN
Cellular LocationNot Available
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDIGHE
HGNC IDHGNC:5522
Chromosome LocationNot Available
Locus14q32.33
References
  1. Max EE, Battey J, Ney R, Kirsch IR, Leder P: Duplication and deletion in the human immunoglobulin epsilon genes. Cell. 1982 Jun;29(2):691-9. 6288268
  2. Flanagan JG, Rabbitts TH: The sequence of a human immunoglobulin epsilon heavy chain constant region gene, and evidence for three non-allelic genes. EMBO J. 1982;1(5):655-60. 6234164
  3. Ueda S, Nakai S, Nishida Y, Hisajima H, Honjo T: Long terminal repeat-like elements flank a human immunoglobulin epsilon pseudogene that lacks introns. EMBO J. 1982;1(12):1539-44. 6327276
  4. Seno M, Kurokawa T, Ono Y, Onda H, Sasada R, Igarashi K, Kikuchi M, Sugino Y, Nishida Y, Honjo T: Molecular cloning and nucleotide sequencing of human immunoglobulin epsilon chain cDNA. Nucleic Acids Res. 1983 Feb 11;11(3):719-26. 6300763
  5. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. 12508121
  6. Kenten JH, Molgaard HV, Houghton M, Derbyshire RB, Viney J, Bell LO, Gould HJ: Cloning and sequence determination of the gene for the human immunoglobulin epsilon chain expressed in a myeloma cell line. Proc Natl Acad Sci U S A. 1982 Nov;79(21):6661-5. 6815656
  7. Padlan EA, Davies DR: A model of the Fc of immunoglobulin E. Mol Immunol. 1986 Oct;23(10):1063-75. 3796618