You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetallothionein-2
Synonyms
  • CES1
  • Metallothionein-2A
  • Metallothionein-II
  • MT-2
  • MT-II
  • MT2
Gene NameMT2A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020797|Metallothionein-2
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
A
Number of residues61
Molecular Weight6042.05
Theoretical pINot Available
GO Classification
Functions
  • drug binding
  • zinc ion binding
Processes
  • cellular response to interleukin-3
  • cellular response to zinc ion
  • cellular copper ion homeostasis
  • cellular response to erythropoietin
  • cytokine-mediated signaling pathway
  • cellular response to drug
  • interferon-gamma-mediated signaling pathway
  • negative regulation of growth
Components
  • cytoplasm
  • nucleus
  • cytosol
  • perinuclear region of cytoplasm
General FunctionZinc ion binding
Specific FunctionMetallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP02795
UniProtKB Entry NameMT2_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0020798|Metallothionein-2 (MT2A)
ATGGATCCCAACTGCTCCTGCGCCGCCGGTGACTCCTGCACCTGCGCCGGCTCCTGCAAA
TGCAAAGAGTGCAAATGCACCTCCTGCAAGAAAAGCTGCTGCTCCTGCTGCCCTGTGGGC
TGTGCCAAGTGTGCCCAGGGCTGCATCTGCAAAGGGGCGTCGGACAAGTGCAGCTGCTGC
GCCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:7406
Chromosome Location16
LocusNot Available
References
  1. Kissling MM, Kagi HR: Primary structure of human hepatic metallothionein. FEBS Lett. 1977 Oct 15;82(2):247-50. 913597
  2. Karin M, Richards RI: Human metallothionein genes--primary structure of the metallothionein-II gene and a related processed gene. Nature. 1982 Oct 28;299(5886):797-802. 7133118
  3. Karin M, Richards RI: Human metallothionein genes: molecular cloning and sequence analysis of the mRNA. Nucleic Acids Res. 1982 May 25;10(10):3165-73. 6896577
  4. Duguid JR, Bohmont CW, Liu NG, Tourtellotte WW: Changes in brain gene expression shared by scrapie and Alzheimer disease. Proc Natl Acad Sci U S A. 1989 Sep;86(18):7260-4. 2780570
  5. Yamazaki S, Nakanishi M, Hamamoto T, Hirata H, Ebihara A, Tokue A, Kagawa Y: Expression of human metallothionein-II fusion protein in Escherichia coli. Biochem Int. 1992 Nov;28(3):451-60. 1339282
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  9. Messerle BA, Schaffer A, Vasak M, Kagi JH, Wuthrich K: Three-dimensional structure of human [113Cd7]metallothionein-2 in solution determined by nuclear magnetic resonance spectroscopy. J Mol Biol. 1990 Aug 5;214(3):765-79. 2388267
  10. Messerle BA, Schaffer A, Vasak M, Kagi JH, Wuthrich K: Comparison of the solution conformations of human [Zn7]-metallothionein-2 and [Cd7]-metallothionein-2 using nuclear magnetic resonance spectroscopy. J Mol Biol. 1992 May 20;225(2):433-43. 1593628