NameX-box-binding protein 1
Synonyms
  • Tax-responsive element-binding protein 5
  • TREB-5
  • TREB5
  • XBP-1
  • XBP2
Gene NameXBP1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009305|X-box-binding protein 1
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP
YQPPFLCQWGRHQPSWKPLMN
Number of residues261
Molecular Weight28694.66
Theoretical pINot Available
GO Classification
Functions
  • transcription regulatory region DNA binding
  • protein heterodimerization activity
  • enhancer sequence-specific DNA binding
  • chromatin DNA binding
  • transcription factor activity, sequence-specific DNA binding
  • protein homodimerization activity
  • RNA polymerase II regulatory region sequence-specific DNA binding
  • core promoter binding
  • protein kinase binding
  • ubiquitin protein ligase binding
  • RNA polymerase II transcription factor activity, sequence-specific DNA binding
  • DNA binding
  • protease binding
  • estrogen receptor binding
Processes
  • positive regulation of proteasomal protein catabolic process
  • cellular response to laminar fluid shear stress
  • cell growth
  • response to endoplasmic reticulum stress
  • negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
  • positive regulation of protein acetylation
  • negative regulation of transcription from RNA polymerase II promoter
  • positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
  • transcription from RNA polymerase II promoter
  • intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
  • protein destabilization
  • positive regulation of transcription factor import into nucleus
  • angiogenesis
  • endothelial cell proliferation
  • response to insulin-like growth factor stimulus
  • cellular response to insulin stimulus
  • cellular response to fructose stimulus
  • response to electrical stimulus
  • adipose tissue development
  • serotonin secretion, neurotransmission
  • cellular response to lipopolysaccharide
  • cellular response to nutrient
  • cellular response to vascular endothelial growth factor stimulus
  • ATF6-mediated unfolded protein response
  • sterol homeostasis
  • cholesterol homeostasis
  • cellular triglyceride homeostasis
  • autophagy
  • positive regulation of immunoglobulin secretion
  • positive regulation of B cell differentiation
  • positive regulation of fat cell differentiation
  • epithelial cell maturation involved in salivary gland development
  • exocrine pancreas development
  • cellular response to oxidative stress
  • positive regulation of endoplasmic reticulum unfolded protein response
  • positive regulation of protein phosphorylation
  • muscle organ development
  • positive regulation of T cell differentiation
  • positive regulation of endothelial cell apoptotic process
  • regulation of autophagy
  • phosphatidylinositol 3-kinase signaling
  • organelle organization
  • cellular response to peptide hormone stimulus
  • positive regulation of ER-associated ubiquitin-dependent protein catabolic process
  • cellular response to amino acid stimulus
  • fatty acid homeostasis
  • negative regulation of endoplasmic reticulum unfolded protein response
  • cellular response to glucose starvation
  • cellular response to fluid shear stress
  • regulation of protein stability
  • positive regulation of histone methylation
  • cellular protein metabolic process
  • cellular response to antibiotic
  • negative regulation of myotube differentiation
  • protein transport
  • endoplasmic reticulum unfolded protein response
  • positive regulation of interleukin-6 secretion
  • positive regulation of immunoglobulin production
  • positive regulation of autophagy
  • positive regulation of hepatocyte proliferation
  • liver development
  • positive regulation of MHC class II biosynthetic process
  • positive regulation of lactation
  • negative regulation of apoptotic process
  • cellular response to glucose stimulus
  • neuron development
  • response to drug
  • positive regulation of TOR signaling
  • positive regulation of phospholipid biosynthetic process by positive regulation of transcription from RNA polymerase II promoter
  • positive regulation of transcription from RNA polymerase II promoter
  • IRE1-mediated unfolded protein response
  • ubiquitin-dependent protein catabolic process
  • immune response
  • fatty acid biosynthetic process
  • positive regulation of plasma cell differentiation
  • vascular endothelial growth factor receptor signaling pathway
  • positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
  • cellular response to interleukin-4
Components
  • integral component of membrane
  • cytosol
  • nucleoplasm
  • cytoplasm
  • nucleus
  • integral component of endoplasmic reticulum membrane
  • endoplasmic reticulum
  • endoplasmic reticulum membrane
General FunctionUbiquitin protein ligase binding
Specific FunctionFunctions as a transcription factor during endoplasmic reticulum (ER) stress by regulating the unfolded protein response (UPR). Required for cardiac myogenesis and hepatogenesis during embryonic development, and the development of secretory tissues such as exocrine pancreas and salivary gland (By similarity). Involved in terminal differentiation of B lymphocytes to plasma cells and production of immunoglobulins (PubMed:11460154). Modulates the cellular response to ER stress in a PIK3R-dependent manner (PubMed:20348923). Binds to the cis-acting X box present in the promoter regions of major histocompatibility complex class II genes (PubMed:8349596). Involved in VEGF-induced endothelial cell (EC) proliferation and retinal blood vessel formation during embryonic development but also for angiogenesis in adult tissues under ischemic conditions. Functions also as a major regulator of the UPR in obesity-induced insulin resistance and type 2 diabetes for the management of obesity and diabetes prevention (By similarity).Isoform 1: plays a role in the unconventional cytoplasmic splicing processing of its own mRNA triggered by the endoplasmic reticulum (ER) transmembrane endoribonuclease ENR1: upon ER stress, the emerging XBP1 polypeptide chain, as part of a mRNA-ribosome-nascent chain (R-RNC) complex, cotranslationally recruits its own unprocessed mRNA through transient docking to the ER membrane and translational pausing, therefore facilitating efficient IRE1-mediated XBP1 mRNA isoform 2 production (PubMed:19394296, PubMed:21233347). In endothelial cells (EC), associated with KDR, promotes IRE1-mediated XBP1 mRNA isoform 2 productions in a vascular endothelial growth factor (VEGF)-dependent manner, leading to EC proliferation and angiogenesis (PubMed:23529610). Functions as a negative feed-back regulator of the potent transcription factor XBP1 isoform 2 protein levels through proteasome-mediated degradation, thus preventing the constitutive activation of the ER stress response signaling pathway (PubMed:16461360, PubMed:25239945). Inhibits the transactivation activity of XBP1 isoform 2 in myeloma cells (By similarity). Acts as a weak transcriptional factor (PubMed:8657566). Together with HDAC3, contributes to the activation of NFE2L2-mediated HMOX1 transcription factor gene expression in a PI(3)K/mTORC2/Akt-dependent signaling pathway leading to EC survival under disturbed flow/oxidative stress (PubMed:25190803). Binds to the ER stress response element (ERSE) upon ER stress (PubMed:11779464). Binds to the consensus 5'-GATGACGTG[TG]N(3)[AT]T-3' sequence related to cAMP responsive element (CRE)-like sequences (PubMed:8657566). Binds the Tax-responsive element (TRE) present in the long terminal repeat (LTR) of T cell leukemia virus type 1 (HTLV-I) and to the TPA response elements (TRE) (PubMed:2321018, PubMed:2196176, PubMed:1903538, PubMed:8657566). Associates preferentially to the HDAC3 gene promoter region in a static flow-dependent manner (PubMed:25190803). Binds to the CDH5/VE-cadherin gene promoter region (PubMed:19416856).Isoform 2: functions as a stress-inducible potent transcriptional activator during endoplasmic reticulum (ER) stress by inducing unfolded protein response (UPR) target genes via binding to the UPR element (UPRE). Up-regulates target genes encoding ER chaperones and ER-associated degradation (ERAD) components to enhance the capacity of productive folding and degradation mechanism, respectively, in order to maintain the homeostasis of the ER under ER stress (PubMed:11779464, PubMed:25239945). Plays a role in the production of immunoglobulins and interleukin-6 in the presence of stimuli required for plasma cell differentiation (By similarity). Induces phospholipid biosynthesis and ER expansion (PubMed:15466483). Contributes to the VEGF-induced endothelial cell (EC) growth and proliferation in a Akt/GSK-dependent and/or -independent signaling pathway, respectively, leading to beta-catenin nuclear translocation and E2F2 gene expression (PubMed:23529610). Promotes umbilical vein EC apoptosis and atherosclerotisis development in a caspase-dependent signaling pathway, and contributes to VEGF-induced EC proliferation and angiogenesis in adult tissues under ischemic conditions (PubMed:19416856, PubMed:23529610). Involved in the regulation of endostatin-induced autophagy in EC through BECN1 transcriptional activation (PubMed:23184933). Plays a role as an oncogene by promoting tumor progression: stimulates zinc finger protein SNAI1 transcription to induce epithelial-to-mesenchymal (EMT) transition, cell migration and invasion of breast cancer cells (PubMed:25280941). Involved in adipocyte differentiation by regulating lipogenic gene expression during lactation. Plays a role in the survival of both dopaminergic neurons of the substantia nigra pars compacta (SNpc), by maintaining protein homeostasis and of myeloma cells. Increases insulin sensitivity in the liver as a response to a high carbohydrate diet, resulting in improved glucose tolerance. Improves also glucose homeostasis in an ER stress- and/or insulin-independent manner through both binding and proteasome-induced degradation of the transcription factor FOXO1, hence resulting in suppression of gluconeogenic genes expression and in a reduction of blood glucose levels. Controls the induction of de novo fatty acid synthesis in hepatocytes by regulating the expression of a subset of lipogenic genes in an ER stress- and UPR-independent manner (By similarity). Associates preferentially to the HDAC3 gene promoter region in a disturbed flow-dependent manner (PubMed:25190803). Binds to the BECN1 gene promoter region (PubMed:23184933). Binds to the CDH5/VE-cadherin gene promoter region (PubMed:19416856). Binds to the ER stress response element (ERSE) upon ER stress (PubMed:11779464). Binds to the 5'-CCACG-3' motif in the PPARG promoter (By similarity).
Pfam Domain Function
Transmembrane Regions186-203
GenBank Protein IDNot Available
UniProtKB IDP17861
UniProtKB Entry NameXBP1_HUMAN
Cellular LocationEndoplasmic reticulum
Gene sequence
>lcl|BSEQ0013730|X-box-binding protein 1 (XBP1)
ATGGTGGTGGTGGCAGCCGCGCCGAACCCGGCCGACGGGACCCCTAAAGTTCTGCTTCTG
TCGGGGCAGCCCGCCTCCGCCGCCGGAGCCCCGGCCGGCCAGGCCCTGCCGCTCATGGTG
CCAGCCCAGAGAGGGGCCAGCCCGGAGGCAGCGAGCGGGGGGCTGCCCCAGGCGCGCAAG
CGACAGCGCCTCACGCACCTGAGCCCCGAGGAGAAGGCGCTGAGGAGGAAACTGAAAAAC
AGAGTAGCAGCTCAGACTGCCAGAGATCGAAAGAAGGCTCGAATGAGTGAGCTGGAACAG
CAAGTGGTAGATTTAGAAGAAGAGAACCAAAAACTTTTGCTAGAAAATCAGCTTTTACGA
GAGAAAACTCATGGCCTTGTAGTTGAGAACCAGGAGTTAAGACAGCGCTTGGGGATGGAT
GCCCTGGTTGCTGAAGAGGAGGCGGAAGCCAAGGGGAATGAAGTGAGGCCAGTGGCCGGG
TCTGCTGAGTCCGCAGCAGGTGCAGGCCCAGTTGTCACCCCTCCAGAACATCTCCCCATG
GATTCTGGCGGTATTGACTCTTCAGATTCAGAGTCTGATATCCTGTTGGGCATTCTGGAC
AACTTGGACCCAGTCATGTTCTTCAAATGCCCTTCCCCAGAGCCTGCCAGCCTGGAGGAG
CTCCCAGAGGTCTACCCAGAAGGACCCAGTTCCTTACCAGCCTCCCTTTCTCTGTCAGTG
GGGACGTCATCAGCCAAGCTGGAAGCCATTAATGAACTAATTCGTTTTGACCACATATAT
ACCAAGCCCCTAGTCTTAGAGATACCCTCTGAGACAGAGAGCCAAGCTAATGTGGTAGTG
AAAATCGAGGAAGCACCTCTCAGCCCCTCAGAGAATGATCACCCTGAATTCATTGTCTCA
GTGAAGGAAGAACCTGTAGAAGATGACCTCGTTCCGGAGCTGGGTATCTCAAATCTGCTT
TCATCCAGCCACTGCCCAAAGCCATCTTCCTGCCTACTGGATGCTTACAGTGACTGTGGA
TACGGGGGTTCCCTTTCCCCATTCAGTGACATGTCCTCTCTGCTTGGTGTAAACCATTCT
TGGGAGGACACTTTTGCCAATGAACTCTTTCCCCAGCTGATTAGTGTCTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:12801
Chromosome Location22
LocusNot Available
References
  1. Liou HC, Boothby MR, Finn PW, Davidon R, Nabavi N, Zeleznik-Le NJ, Ting JP, Glimcher LH: A new member of the leucine zipper class of proteins that binds to the HLA DR alpha promoter. Science. 1990 Mar 30;247(4950):1581-4. 2321018
  2. Yoshimura T, Fujisawa J, Yoshida M: Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain. EMBO J. 1990 Aug;9(8):2537-42. 2196176
  3. Ponath PD, Fass D, Liou HC, Glimcher LH, Strominger JL: The regulatory gene, hXBP-1, and its target, HLA-DRA, utilize both common and distinct regulatory elements and protein complexes. J Biol Chem. 1993 Aug 15;268(23):17074-82. 8349596
  4. Yoshida H, Matsui T, Yamamoto A, Okada T, Mori K: XBP1 mRNA is induced by ATF6 and spliced by IRE1 in response to ER stress to produce a highly active transcription factor. Cell. 2001 Dec 28;107(7):881-91. 11779464
  5. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  6. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Ono SJ, Liou HC, Davidon R, Strominger JL, Glimcher LH: Human X-box-binding protein 1 is required for the transcription of a subset of human class II major histocompatibility genes and forms a heterodimer with c-fos. Proc Natl Acad Sci U S A. 1991 May 15;88(10):4309-12. 1903538
  9. Reimold AM, Ponath PD, Li YS, Hardy RR, David CS, Strominger JL, Glimcher LH: Transcription factor B cell lineage-specific activator protein regulates the gene for human X-box binding protein 1. J Exp Med. 1996 Feb 1;183(2):393-401. 8627152
  10. Clauss IM, Chu M, Zhao JL, Glimcher LH: The basic domain/leucine zipper protein hXBP-1 preferentially binds to and transactivates CRE-like sequences containing an ACGT core. Nucleic Acids Res. 1996 May 15;24(10):1855-64. 8657566
  11. Wen XY, Stewart AK, Sooknanan RR, Henderson G, Hawley TS, Reimold AM, Glimcher LH, Baumann H, Malek LT, Hawley RG: Identification of c-myc promoter-binding protein and X-box binding protein 1 as interleukin-6 target genes in human multiple myeloma cells. Int J Oncol. 1999 Jul;15(1):173-8. 10375612
  12. Reimold AM, Iwakoshi NN, Manis J, Vallabhajosyula P, Szomolanyi-Tsuda E, Gravallese EM, Friend D, Grusby MJ, Alt F, Glimcher LH: Plasma cell differentiation requires the transcription factor XBP-1. Nature. 2001 Jul 19;412(6844):300-7. 11460154
  13. Kakiuchi C, Iwamoto K, Ishiwata M, Bundo M, Kasahara T, Kusumi I, Tsujita T, Okazaki Y, Nanko S, Kunugi H, Sasaki T, Kato T: Impaired feedback regulation of XBP1 as a genetic risk factor for bipolar disorder. Nat Genet. 2003 Oct;35(2):171-5. Epub 2003 Aug 31. 12949534
  14. Sriburi R, Jackowski S, Mori K, Brewer JW: XBP1: a link between the unfolded protein response, lipid biosynthesis, and biogenesis of the endoplasmic reticulum. J Cell Biol. 2004 Oct 11;167(1):35-41. Epub 2004 Oct 4. 15466483
  15. Yoshida H, Nadanaka S, Sato R, Mori K: XBP1 is critical to protect cells from endoplasmic reticulum stress: evidence from Site-2 protease-deficient Chinese hamster ovary cells. Cell Struct Funct. 2006;31(2):117-25. Epub 2006 Nov 17. 17110785
  16. Yoshida H, Oku M, Suzuki M, Mori K: pXBP1(U) encoded in XBP1 pre-mRNA negatively regulates unfolded protein response activator pXBP1(S) in mammalian ER stress response. J Cell Biol. 2006 Feb 13;172(4):565-75. Epub 2006 Feb 6. 16461360
  17. Yamamoto K, Sato T, Matsui T, Sato M, Okada T, Yoshida H, Harada A, Mori K: Transcriptional induction of mammalian ER quality control proteins is mediated by single or combined action of ATF6alpha and XBP1. Dev Cell. 2007 Sep;13(3):365-76. 17765680
  18. Uemura A, Oku M, Mori K, Yoshida H: Unconventional splicing of XBP1 mRNA occurs in the cytoplasm during the mammalian unfolded protein response. J Cell Sci. 2009 Aug 15;122(Pt 16):2877-86. doi: 10.1242/jcs.040584. Epub 2009 Jul 21. 19622636
  19. Yanagitani K, Imagawa Y, Iwawaki T, Hosoda A, Saito M, Kimata Y, Kohno K: Cotranslational targeting of XBP1 protein to the membrane promotes cytoplasmic splicing of its own mRNA. Mol Cell. 2009 Apr 24;34(2):191-200. doi: 10.1016/j.molcel.2009.02.033. 19394296
  20. Zeng L, Zampetaki A, Margariti A, Pepe AE, Alam S, Martin D, Xiao Q, Wang W, Jin ZG, Cockerill G, Mori K, Li YS, Hu Y, Chien S, Xu Q: Sustained activation of XBP1 splicing leads to endothelial apoptosis and atherosclerosis development in response to disturbed flow. Proc Natl Acad Sci U S A. 2009 May 19;106(20):8326-31. doi: 10.1073/pnas.0903197106. Epub 2009 May 1. 19416856
  21. Winnay JN, Boucher J, Mori MA, Ueki K, Kahn CR: A regulatory subunit of phosphoinositide 3-kinase increases the nuclear accumulation of X-box-binding protein-1 to modulate the unfolded protein response. Nat Med. 2010 Apr;16(4):438-45. doi: 10.1038/nm.2121. Epub 2010 Mar 28. 20348923
  22. Wang FM, Chen YJ, Ouyang HJ: Regulation of unfolded protein response modulator XBP1s by acetylation and deacetylation. Biochem J. 2011 Jan 1;433(1):245-52. doi: 10.1042/BJ20101293. 20955178
  23. Yanagitani K, Kimata Y, Kadokura H, Kohno K: Translational pausing ensures membrane targeting and cytoplasmic splicing of XBP1u mRNA. Science. 2011 Feb 4;331(6017):586-9. doi: 10.1126/science.1197142. Epub 2011 Jan 13. 21233347
  24. Zeng L, Xiao Q, Chen M, Margariti A, Martin D, Ivetic A, Xu H, Mason J, Wang W, Cockerill G, Mori K, Li JY, Chien S, Hu Y, Xu Q: Vascular endothelial cell growth-activated XBP1 splicing in endothelial cells is crucial for angiogenesis. Circulation. 2013 Apr 23;127(16):1712-22. doi: 10.1161/CIRCULATIONAHA.112.001337. Epub 2013 Mar 25. 23529610
  25. Margariti A, Li H, Chen T, Martin D, Vizcay-Barrena G, Alam S, Karamariti E, Xiao Q, Zampetaki A, Zhang Z, Wang W, Jiang Z, Gao C, Ma B, Chen YG, Cockerill G, Hu Y, Xu Q, Zeng L: XBP1 mRNA splicing triggers an autophagic response in endothelial cells through BECLIN-1 transcriptional activation. J Biol Chem. 2013 Jan 11;288(2):859-72. doi: 10.1074/jbc.M112.412783. Epub 2012 Nov 26. 23184933
  26. Li H, Chen X, Gao Y, Wu J, Zeng F, Song F: XBP1 induces snail expression to promote epithelial- to-mesenchymal transition and invasion of breast cancer cells. Cell Signal. 2015 Jan;27(1):82-9. doi: 10.1016/j.cellsig.2014.09.018. Epub 2014 Oct 2. 25280941
  27. Chen CY, Malchus NS, Hehn B, Stelzer W, Avci D, Langosch D, Lemberg MK: Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u. EMBO J. 2014 Nov 3;33(21):2492-506. doi: 10.15252/embj.201488208. Epub 2014 Sep 19. 25239945
  28. Martin D, Li Y, Yang J, Wang G, Margariti A, Jiang Z, Yu H, Zampetaki A, Hu Y, Xu Q, Zeng L: Unspliced X-box-binding protein 1 (XBP1) protects endothelial cells from oxidative stress through interaction with histone deacetylase 3. J Biol Chem. 2014 Oct 31;289(44):30625-34. doi: 10.1074/jbc.M114.571984. Epub 2014 Sep 4. 25190803
  29. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974
  30. Chanock SJ, Burdett L, Yeager M, Llaca V, Langerod A, Presswalla S, Kaaresen R, Strausberg RL, Gerhard DS, Kristensen V, Perou CM, Borresen-Dale AL: Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas. Breast Cancer Res. 2007;9(1):R5. 17224074