NameC-C motif chemokine 8
Synonyms
  • HC14
  • MCP-2
  • MCP2
  • Monocyte chemoattractant protein 2
  • Monocyte chemotactic protein 2
  • SCYA10
  • SCYA8
  • Small-inducible cytokine A8
Gene NameCCL8
OrganismHuman
Amino acid sequence
>lcl|BSEQ0005749|C-C motif chemokine 8
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Number of residues99
Molecular Weight11246.24
Theoretical pI9.84
GO Classification
Functions
  • CCR chemokine receptor binding
  • phospholipase activator activity
  • heparin binding
  • protein kinase activity
  • chemokine activity
Processes
  • cellular response to interferon-gamma
  • cell-cell signaling
  • eosinophil chemotaxis
  • chemotaxis
  • lymphocyte chemotaxis
  • cellular response to tumor necrosis factor
  • exocytosis
  • protein phosphorylation
  • G-protein coupled receptor signaling pathway
  • neutrophil chemotaxis
  • positive regulation of GTPase activity
  • cellular calcium ion homeostasis
  • positive regulation of ERK1 and ERK2 cascade
  • response to virus
  • calcium ion transport
  • monocyte chemotaxis
  • signal transduction
  • positive regulation of leukocyte migration
  • negative regulation of leukocyte proliferation
  • chemokine-mediated signaling pathway
  • cellular response to interleukin-1
  • inflammatory response
Components
  • cell
  • extracellular space
General FunctionProtein kinase activity
Specific FunctionChemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP80075
UniProtKB Entry NameCCL8_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0020638|C-C motif chemokine 8 (CCL8)
ATGAAGGTTTCTGCAGCGCTTCTGTGCCTGCTGCTCATGGCAGCCACTTTCAGCCCTCAG
GGACTTGCTCAGCCAGATTCAGTTTCCATTCCAATCACCTGCTGCTTTAACGTGATCAAT
AGGAAAATTCCTATCCAGAGGCTGGAGAGCTACACAAGAATCACCAACATCCAATGTCCC
AAGGAAGCTGTGATCTTCAAGACCAAACGGGGCAAGGAGGTCTGTGCTGACCCCAAGGAG
AGATGGGTCAGGGATTCCATGAAGCATCTGGACCAAATATTTCAAAATCTGAAGCCATGA
GenBank Gene IDY10802
GeneCard IDNot Available
GenAtlas IDCCL8
HGNC IDHGNC:10635
Chromosome Location17
Locus17q11.2
References
  1. Van Coillie E, Fiten P, Nomiyama H, Sakaki Y, Miura R, Yoshie O, Van Damme J, Opdenakker G: The human MCP-2 gene (SCYA8): cloning, sequence analysis, tissue expression, and assignment to the CC chemokine gene contig on chromosome 17q11.2. Genomics. 1997 Mar 1;40(2):323-31. 9119400
  2. Van Coillie E, Froyen G, Nomiyama H, Miura R, Fiten P, Van Aelst I, Van Damme J, Opdenakker G: Human monocyte chemotactic protein-2: cDNA cloning and regulated expression of mRNA in mesenchymal cells. Biochem Biophys Res Commun. 1997 Feb 24;231(3):726-30. 9070881
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Chang HC, Hsu F, Freeman GJ, Griffin JD, Reinherz EL: Cloning and expression of a gamma-interferon-inducible gene in monocytes: a new member of a cytokine gene family. Int Immunol. 1989;1(4):388-97. 2518726
  5. Van Damme J, Proost P, Lenaerts JP, Opdenakker G: Structural and functional identification of two human, tumor-derived monocyte chemotactic proteins (MCP-2 and MCP-3) belonging to the chemokine family. J Exp Med. 1992 Jul 1;176(1):59-65. 1613466
  6. Kim KS, Rajarathnam K, Clark-Lewis I, Sykes BD: Structural characterization of a monomeric chemokine: monocyte chemoattractant protein-3. FEBS Lett. 1996 Oct 21;395(2-3):277-82. 8898111
  7. Proost P, Struyf S, Couvreur M, Lenaerts JP, Conings R, Menten P, Verhaert P, Wuyts A, Van Damme J: Posttranslational modifications affect the activity of the human monocyte chemotactic proteins MCP-1 and MCP-2: identification of MCP-2(6-76) as a natural chemokine inhibitor. J Immunol. 1998 Apr 15;160(8):4034-41. 9558113
  8. Blaszczyk J, Coillie EV, Proost P, Damme JV, Opdenakker G, Bujacz GD, Wang JM, Ji X: Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors. Biochemistry. 2000 Nov 21;39(46):14075-81. 11087354