NameReceptor-type tyrosine-protein phosphatase eta
Synonyms
  • 3.1.3.48
  • Density-enhanced phosphatase 1
  • DEP-1
  • DEP1
  • HPTP eta
  • Protein-tyrosine phosphatase eta
  • Protein-tyrosine phosphatase receptor type J
  • R-PTP-J
Gene NamePTPRJ
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009009|Receptor-type tyrosine-protein phosphatase eta
MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
ENLAPVTTFGKTNGYIA
Number of residues1337
Molecular Weight145940.37
Theoretical pINot Available
GO Classification
Functions
  • platelet-derived growth factor receptor binding
  • beta-catenin binding
  • delta-catenin binding
  • gamma-catenin binding
  • protein tyrosine phosphatase activity
  • mitogen-activated protein kinase binding
  • protein kinase binding
  • phosphatase activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • negative regulation of cell migration
  • negative regulation of protein kinase B signaling
  • negative regulation of epidermal growth factor receptor signaling pathway
  • T cell receptor signaling pathway
  • contact inhibition
  • negative regulation of cell growth
  • negative regulation of T cell receptor signaling pathway
  • positive regulation of protein kinase B signaling
  • regulation of cell adhesion
  • positive regulation of focal adhesion assembly
  • negative regulation of platelet-derived growth factor receptor signaling pathway
  • oligodendrocyte differentiation
  • positive regulation of cell adhesion
  • platelet-derived growth factor receptor signaling pathway
  • negative regulation of MAP kinase activity
  • negative regulation of vascular permeability
  • heart development
  • vasculogenesis
  • negative regulation of cell proliferation
  • positive chemotaxis
Components
  • cell-cell junction
  • immunological synapse
  • ruffle membrane
  • plasma membrane
  • cell surface
  • extracellular exosome
  • integral component of plasma membrane
General FunctionProtein tyrosine phosphatase activity
Specific FunctionTyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, FLT3, PDGFRB, MET, RET (variant MEN2A), KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2. Plays a role in cell adhesion, migration, proliferation and differentiation. Involved in vascular development. Regulator of macrophage adhesion and spreading. Positively affects cell-matrix adhesion. Positive regulator of platelet activation and thrombosis. Negative regulator of cell proliferation. Negative regulator of PDGF-stimulated cell migration; through dephosphorylation of PDGFR. Positive regulator of endothelial cell survival, as well as of VEGF-induced SRC and AKT activation; through KDR dephosphorylation. Negative regulator of EGFR signaling pathway; through EGFR dephosphorylation. Enhances the barrier function of epithelial junctions during reassembly. Negatively regulates T-cell receptor (TCR) signaling. Upon T-cell TCR activation, it is up-regulated and excluded from the immunological synapses, while upon T-cell-antigen presenting cells (APC) disengagement, it is no longer excluded and can dephosphorylate PLCG1 and LAT to down-regulate prolongation of signaling.
Pfam Domain Function
Transmembrane Regions976-996
GenBank Protein IDNot Available
UniProtKB IDQ12913
UniProtKB Entry NamePTPRJ_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013561|Receptor-type tyrosine-protein phosphatase eta (PTPRJ)
ATGAAGCCGGCGGCGCGGGAGGCGCGGCTGCCTCCGCGCTCGCCCGGGCTGCGCTGGGCG
CTGCCGCTGCTGCTGCTGCTGCTGCGCCTGGGCCAGATCCTGTGCGCAGGTGGCACCCCT
AGTCCAATTCCTGACCCTTCAGTAGCAACTGTTGCCACAGGGGAAAATGGCATAACGCAG
ATCAGCAGTACAGCAGAATCCTTTCATAAACAGAATGGAACTGGAACACCTCAGGTGGAA
ACAAACACCAGTGAGGATGGTGAAAGCTCTGGAGCCAACGATAGTTTAAGAACACCTGAA
CAAGGATCTAATGGGACTGATGGGGCATCTCAAAAAACTCCCAGTAGCACTGGGCCCAGT
CCTGTGTTTGACATTAAAGCTGTTTCCATCAGTCCAACCAATGTGATCTTAACTTGGAAA
AGTAATGACACAGCTGCTTCTGAGTACAAGTATGTAGTAAAGCATAAGATGGAAAATGAG
AAGACAATTACTGTTGTGCATCAACCATGGTGTAACATCACAGGCTTACGTCCAGCGACT
TCATATGTATTCTCCATCACTCCAGGAATAGGCAATGAGACTTGGGGAGATCCCAGAGTC
ATAAAAGTCATCACAGAGCCGATCCCAGTTTCTGATCTCCGTGTTGCCCTCACGGGTGTG
AGGAAGGCTGCTCTCTCCTGGAGCAATGGCAATGGCACTGCCTCCTGCCGGGTTCTTCTT
GAAAGCATTGGAAGCCATGAGGAGTTGACTCAAGACTCAAGACTTCAGGTCAATATCTCG
GGCCTGAAGCCAGGGGTTCAATACAACATCAACCCGTATCTTCTACAATCAAATAAGACA
AAGGGAGACCCCTTGGGCACAGAAGGTGGCTTGGATGCCAGCAATACAGAGAGAAGCCGG
GCAGGGAGCCCCACCGCCCCTGTGCATGATGAGTCCCTCGTGGGACCTGTGGACCCATCC
TCCGGCCAGCAGTCCCGAGACACGGAAGTCCTGCTTGTCGGGTTAGAGCCTGGCACCCGA
TACAATGCCACCGTTTATTCCCAAGCAGCGAATGGCACAGAAGGACAGCCCCAGGCCATA
GAGTTCAGGACAAATGCTATTCAGGTTTTTGACGTCACCGCTGTGAACATCAGTGCCACA
AGCCTGACCCTGATCTGGAAAGTCAGCGATAACGAGTCGTCATCTAACTATACCTACAAG
ATACATGTGGCGGGGGAGACAGATTCTTCCAATCTCAACGTCAGTGAGCCTCGCGCTGTC
ATCCCCGGACTCCGCTCCAGCACCTTCTACAACATCACAGTGTGTCCTGTCCTAGGTGAC
ATCGAGGGCACGCCGGGCTTCCTCCAAGTGCACACCCCCCCTGTTCCAGTTTCTGACTTC
CGAGTGACAGTGGTCAGCACGACGGAGATCGGCTTAGCATGGAGCAGCCATGATGCAGAA
TCATTTCAGATGCATATCACACAGGAGGGAGCTGGCAATTCTCGGGTAGAAATAACCACC
AACCAAAGTATTATCATTGGTGGCTTGTTCCCTGGAACCAAGTATTGCTTTGAAATAGTT
CCAAAAGGACCAAATGGGACTGAAGGGGCATCTCGGACAGTTTGCAATAGAACTGGATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9673
Chromosome Location11
LocusNot Available
References
  1. Ostman A, Yang Q, Tonks NK: Expression of DEP-1, a receptor-like protein-tyrosine-phosphatase, is enhanced with increasing cell density. Proc Natl Acad Sci U S A. 1994 Oct 11;91(21):9680-4. 7937872
  2. Honda H, Inazawa J, Nishida J, Yazaki Y, Hirai H: Molecular cloning, characterization, and chromosomal localization of a novel protein-tyrosine phosphatase, HPTP eta. Blood. 1994 Dec 15;84(12):4186-94. 7994032
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Ruivenkamp CA, van Wezel T, Zanon C, Stassen AP, Vlcek C, Csikos T, Klous AM, Tripodis N, Perrakis A, Boerrigter L, Groot PC, Lindeman J, Mooi WJ, Meijjer GA, Scholten G, Dauwerse H, Paces V, van Zandwijk N, van Ommen GJ, Demant P: Ptprj is a candidate for the mouse colon-cancer susceptibility locus Scc1 and is frequently deleted in human cancers. Nat Genet. 2002 Jul;31(3):295-300. Epub 2002 Jun 24. 12089527
  6. Honda H, Shibuya M, Chiba S, Yazaki Y, Hirai H: Identification of novel protein-tyrosine phosphatases in a human leukemia cell line, F-36P. Leukemia. 1993 May;7(5):742-6. 8483328
  7. de la Fuente-Garcia MA, Nicolas JM, Freed JH, Palou E, Thomas AP, Vilella R, Vives J, Gaya A: CD148 is a membrane protein tyrosine phosphatase present in all hematopoietic lineages and is involved in signal transduction on lymphocytes. Blood. 1998 Apr 15;91(8):2800-9. 9531590
  8. Tangye SG, Wu J, Aversa G, de Vries JE, Lanier LL, Phillips JH: Negative regulation of human T cell activation by the receptor-type protein tyrosine phosphatase CD148. J Immunol. 1998 Oct 15;161(8):3803-7. 9780142
  9. Kovalenko M, Denner K, Sandstrom J, Persson C, Gross S, Jandt E, Vilella R, Bohmer F, Ostman A: Site-selective dephosphorylation of the platelet-derived growth factor beta-receptor by the receptor-like protein-tyrosine phosphatase DEP-1. J Biol Chem. 2000 May 26;275(21):16219-26. 10821867
  10. Baker JE, Majeti R, Tangye SG, Weiss A: Protein tyrosine phosphatase CD148-mediated inhibition of T-cell receptor signal transduction is associated with reduced LAT and phospholipase Cgamma1 phosphorylation. Mol Cell Biol. 2001 Apr;21(7):2393-403. 11259588
  11. Persson C, Engstrom U, Mowbray SL, Ostman A: Primary sequence determinants responsible for site-selective dephosphorylation of the PDGF beta-receptor by the receptor-like protein tyrosine phosphatase DEP-1. FEBS Lett. 2002 Apr 24;517(1-3):27-31. 12062403
  12. Holsinger LJ, Ward K, Duffield B, Zachwieja J, Jallal B: The transmembrane receptor protein tyrosine phosphatase DEP1 interacts with p120(ctn). Oncogene. 2002 Oct 10;21(46):7067-76. 12370829
  13. Palka HL, Park M, Tonks NK: Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1. J Biol Chem. 2003 Feb 21;278(8):5728-35. Epub 2002 Dec 9. 12475979
  14. Lin J, Weiss A: The tyrosine phosphatase CD148 is excluded from the immunologic synapse and down-regulates prolonged T cell signaling. J Cell Biol. 2003 Aug 18;162(4):673-82. Epub 2003 Aug 11. 12913111
  15. Kellie S, Craggs G, Bird IN, Jones GE: The tyrosine phosphatase DEP-1 induces cytoskeletal rearrangements, aberrant cell-substratum interactions and a reduction in cell proliferation. J Cell Sci. 2004 Feb 1;117(Pt 4):609-18. Epub 2004 Jan 6. 14709717
  16. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  17. Iervolino A, Iuliano R, Trapasso F, Viglietto G, Melillo RM, Carlomagno F, Santoro M, Fusco A: The receptor-type protein tyrosine phosphatase J antagonizes the biochemical and biological effects of RET-derived oncoproteins. Cancer Res. 2006 Jun 15;66(12):6280-7. 16778204
  18. Balavenkatraman KK, Jandt E, Friedrich K, Kautenburger T, Pool-Zobel BL, Ostman A, Bohmer FD: DEP-1 protein tyrosine phosphatase inhibits proliferation and migration of colon carcinoma cells and is upregulated by protective nutrients. Oncogene. 2006 Oct 12;25(47):6319-24. Epub 2006 May 8. 16682945
  19. Tsuboi N, Utsunomiya T, Roberts RL, Ito H, Takahashi K, Noda M, Takahashi T: The tyrosine phosphatase CD148 interacts with the p85 regulatory subunit of phosphoinositide 3-kinase. Biochem J. 2008 Jul 1;413(1):193-200. doi: 10.1042/BJ20071317. 18348712
  20. Senis YA, Tomlinson MG, Ellison S, Mazharian A, Lim J, Zhao Y, Kornerup KN, Auger JM, Thomas SG, Dhanjal T, Kalia N, Zhu JW, Weiss A, Watson SP: The tyrosine phosphatase CD148 is an essential positive regulator of platelet activation and thrombosis. Blood. 2009 May 14;113(20):4942-54. doi: 10.1182/blood-2008-08-174318. Epub 2009 Feb 25. 19246339
  21. Tarcic G, Boguslavsky SK, Wakim J, Kiuchi T, Liu A, Reinitz F, Nathanson D, Takahashi T, Mischel PS, Ng T, Yarden Y: An unbiased screen identifies DEP-1 tumor suppressor as a phosphatase controlling EGFR endocytosis. Curr Biol. 2009 Nov 17;19(21):1788-98. doi: 10.1016/j.cub.2009.09.048. 19836242
  22. Sallee JL, Burridge K: Density-enhanced phosphatase 1 regulates phosphorylation of tight junction proteins and enhances barrier function of epithelial cells. J Biol Chem. 2009 May 29;284(22):14997-5006. doi: 10.1074/jbc.M901901200. Epub 2009 Mar 30. 19332538
  23. Sacco F, Tinti M, Palma A, Ferrari E, Nardozza AP, Hooft van Huijsduijnen R, Takahashi T, Castagnoli L, Cesareni G: Tumor suppressor density-enhanced phosphatase-1 (DEP-1) inhibits the RAS pathway by direct dephosphorylation of ERK1/2 kinases. J Biol Chem. 2009 Aug 14;284(33):22048-58. doi: 10.1074/jbc.M109.002758. Epub 2009 Jun 3. 19494114
  24. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218
  25. Chabot C, Spring K, Gratton JP, Elchebly M, Royal I: New role for the protein tyrosine phosphatase DEP-1 in Akt activation and endothelial cell survival. Mol Cell Biol. 2009 Jan;29(1):241-53. doi: 10.1128/MCB.01374-08. Epub 2008 Oct 20. 18936167
  26. Petermann A, Haase D, Wetzel A, Balavenkatraman KK, Tenev T, Guhrs KH, Friedrich S, Nakamura M, Mawrin C, Bohmer FD: Loss of the protein-tyrosine phosphatase DEP-1/PTPRJ drives meningioma cell motility. Brain Pathol. 2011 Jul;21(4):405-18. doi: 10.1111/j.1750-3639.2010.00464.x. Epub 2010 Dec 27. 21091576
  27. Omerovic J, Clague MJ, Prior IA: Phosphatome profiling reveals PTPN2, PTPRJ and PTEN as potent negative regulators of PKB/Akt activation in Ras-mutated cancer cells. Biochem J. 2010 Jan 27;426(1):65-72. doi: 10.1042/BJ20091413. 19922411
  28. Arora D, Stopp S, Bohmer SA, Schons J, Godfrey R, Masson K, Razumovskaya E, Ronnstrand L, Tanzer S, Bauer R, Bohmer FD, Muller JP: Protein-tyrosine phosphatase DEP-1 controls receptor tyrosine kinase FLT3 signaling. J Biol Chem. 2011 Apr 1;286(13):10918-29. doi: 10.1074/jbc.M110.205021. Epub 2011 Jan 24. 21262971
  29. Iuliano R, Le Pera I, Cristofaro C, Baudi F, Arturi F, Pallante P, Martelli ML, Trapasso F, Chiariotti L, Fusco A: The tyrosine phosphatase PTPRJ/DEP-1 genotype affects thyroid carcinogenesis. Oncogene. 2004 Nov 4;23(52):8432-8. 15378013