You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NametRNA (cytosine(38)-C(5))-methyltransferase
Synonyms
  • 2.1.1.204
  • DNA (cytosine-5)-methyltransferase-like protein 2
  • DNA methyltransferase homolog HsaIIP
  • DNA MTase homolog HsaIIP
  • DNMT2
  • M.HsaIIP
  • PuMet
Gene NameTRDMT1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004943|tRNA (cytosine(38)-C(5))-methyltransferase
MEPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGI
TLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLEN
VKGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPG
QVLMEFPKIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHR
KNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSY
IEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGF
PEKITVKQRYRLLGNSLNVHVVAKLIKILYE
Number of residues391
Molecular Weight44596.17
Theoretical pI5.95
GO Classification
Functions
  • tRNA methyltransferase activity
  • DNA (cytosine-5-)-methyltransferase activity
  • RNA binding
Processes
  • tRNA modification
  • tRNA processing
  • gene expression
  • response to amphetamine
  • tRNA methylation
  • C-5 methylation of cytosine
Components
  • nucleoplasm
  • cytoplasm
General FunctionTrna methyltransferase activity
Specific FunctionSpecifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO14717
UniProtKB Entry NameTRDMT_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0011795|tRNA (cytosine(38)-C(5))-methyltransferase (TRDMT1)
ATGGAGCCCCTGCGGGTGCTGGAGCTATACAGCGGCGTGGGCGGCATGCACCACGCGCTG
AGAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACTGTCGCTAAT
GAAGTATACAAGTATAATTTTCCTCACACACAGTTACTTGCCAAGACGATTGAAGGCATT
ACACTCGAAGAGTTTGACAGATTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAG
CCATTCACAAGGATTGGCCGGCAGGGTGATATGACTGATTCAAGGACGAATAGCTTCTTA
CATATTCTAGATATTCTCCCAAGATTACAAAAATTACCAAAGTATATTCTTTTGGAAAAT
GTTAAAGGTTTTGAAGTATCTTCTACAAGAGACCTCTTGATACAAACAATAGAAAATTGT
GGCTTTCAGTACCAAGAGTTTCTATTATCTCCAACCTCTCTTGGCATTCCAAATTCAAGG
CTACGATATTTTCTTATTGCAAAGCTTCAGTCAGAGCCATTACCCTTTCAAGCCCCTGGT
CAGGTACTGATGGAGTTCCCCAAAATTGAATCTGTACATCCACAAAAATATGCAATGGAT
GTAGAAAATAAAATTCAAGAAAAGAACGTTGAACCAAATATTAGCTTTGATGGCAGCATA
CAGTGTTCTGGAAAAGATGCCATTCTTTTTAAGCTTGAAACTGCAGAAGAAATTCACAGG
AAAAATCAACAAGATAGTGATCTCTCTGTGAAAATGCTAAAAGATTTTCTTGAAGATGAC
ACTGACGTGAACCAGTATCTTTTACCACCAAAGTCATTGCTGCGATATGCTCTTCTGTTA
GACATTGTTCAGCCCACTTGTAGAAGGTCCGTGTGCTTTACCAAAGGATATGGAAGCTAC
ATAGAAGGGACAGGGTCTGTGTTACAGACTGCAGAGGATGTGCAGGTTGAGAATATCTAC
AAATCCCTTACCAATTTGTCACAAGAAGAACAGATAACAAAGCTGTTAATACTTAAACTG
CGATATTTCACTCCTAAAGAAATAGCAAATCTCCTTGGATTTCCTCCAGAGTTCGGATTT
CCTGAGAAGATAACAGTGAAACAGCGTTATCGCCTACTTGGAAATAGTCTCAACGTGCAT
GTAGTAGCTAAACTAATCAAAATCTTATATGAATAA
GenBank Gene IDAF012128
GeneCard IDNot Available
GenAtlas IDTRDMT1
HGNC IDHGNC:2977
Chromosome Location10
Locus10p15.1
References
  1. Yoder JA, Bestor TH: A candidate mammalian DNA methyltransferase related to pmt1p of fission yeast. Hum Mol Genet. 1998 Feb;7(2):279-84. 9425235
  2. Van den Wyngaert I, Sprengel J, Kass SU, Luyten WH: Cloning and analysis of a novel human putative DNA methyltransferase. FEBS Lett. 1998 Apr 17;426(2):283-9. 9599025
  3. Okano M, Xie S, Li E: Dnmt2 is not required for de novo and maintenance methylation of viral DNA in embryonic stem cells. Nucleic Acids Res. 1998 Jun 1;26(11):2536-40. 9592134
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Franchina M, Hooper J, Kay PH: Five novel alternatively spliced transcripts of DNA (cytosine-5) methyltransferase 2 in human peripheral blood leukocytes. Int J Biochem Cell Biol. 2001 Nov;33(11):1104-15. 11551826
  7. Goll MG, Kirpekar F, Maggert KA, Yoder JA, Hsieh CL, Zhang X, Golic KG, Jacobsen SE, Bestor TH: Methylation of tRNAAsp by the DNA methyltransferase homolog Dnmt2. Science. 2006 Jan 20;311(5759):395-8. 16424344
  8. Dong A, Yoder JA, Zhang X, Zhou L, Bestor TH, Cheng X: Structure of human DNMT2, an enigmatic DNA methyltransferase homolog that displays denaturant-resistant binding to DNA. Nucleic Acids Res. 2001 Jan 15;29(2):439-48. 11139614