You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameC-Jun-amino-terminal kinase-interacting protein 4
Synonyms
  • Cancer/testis antigen 89
  • CT89
  • HLC-6
  • HSS
  • Human lung cancer oncogene 6 protein
  • JIP-4
  • JLP
  • JNK-associated leucine-zipper protein
  • KIAA0516
  • MAPK8IP4
  • Mitogen-activated protein kinase 8-interacting protein 4
  • PHET
  • Proliferation-inducing protein 6
  • Protein highly expressed in testis
  • Sperm surface protein
  • Sperm-associated antigen 9
  • Sperm-specific protein
  • Sunday driver 1
  • SYD1
Gene NameSPAG9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008752|C-Jun-amino-terminal kinase-interacting protein 4
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QLSGSDQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQP
RSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPASTANSDVATIPTDTPLKEENEG
FVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGY
KGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL
LETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEA
EDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRE
NPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLP
GDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNG
QGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLD
TEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQPGN
ILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLG
GITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAG
SAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVRE
EAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADG
TLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEK
SFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGK
LGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENSDK
VTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEP
GSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGN
E
Number of residues1321
Molecular Weight146204.38
Theoretical pINot Available
GO Classification
Functions
  • JUN kinase binding
  • kinesin binding
  • MAP-kinase scaffold activity
  • receptor signaling complex scaffold activity
Processes
  • protein homooligomerization
  • spermatogenesis
  • negative regulation of protein homodimerization activity
  • striated muscle cell differentiation
  • retrograde transport, endosome to Golgi
  • muscle cell differentiation
  • positive regulation of muscle cell differentiation
  • activation of JUN kinase activity
  • positive regulation of cell migration
  • positive regulation of neuron differentiation
Components
  • microtubule organizing center
  • cytoplasm
  • acrosomal vesicle
  • integral component of membrane
  • cytosol
  • extracellular exosome
  • perinuclear region of cytoplasm
General FunctionReceptor signaling complex scaffold activity
Specific FunctionThe JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. Isoform 5 may play a role in spermatozoa-egg-interaction.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO60271
UniProtKB Entry NameJIP4_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019660|C-Jun-amino-terminal kinase-interacting protein 4 (SPAG9)
ATGGAGCTGGAGGACGGTGTGGTGTATCAGGAGGAGCCCGGCGGCTCCGGGGCCGTGATG
TCGGAGCGGGTGTCCGGCCTGGCCGGCTCCATCTACCGCGAGTTCGAGCGGCTTATCGGG
CGCTATGACGAGGAGGTGGTCAAAGAGCTGATGCCGCTGGTGGTGGCTGTGCTGGAGAAC
CTGGACTCGGTGTTCGCGCAGGACCAGGAGCACCAGGTGGAGCTGGAGCTGCTGCGGGAC
GACAACGAGCAGCTCATCACCCAGTACGAGCGGGAGAAGGCGCTGCGCAAGCACGCTGAG
GAGAAATTCATTGAATTTGAAGACTCTCAAGAACAGGAAAAAAAGGACTTACAGACCCGA
GTGGAATCTTTAGAATCTCAAACAAGACAACTTGAGCTGAAAGCGAAAAACTATGCTGAC
CAGATTAGCAGACTTGAAGAAAGAGAAGCAGAACTGAAGAAGGAATATAATGCATTACAT
CAAAGACACACTGAGATGATCCATAATTATATGGAACATTTAGAAAGAACAAAACTTCAT
CAGCTCTCAGGGAGTGATCAACTAGAATCCACAGCTCATAGTAGAATTAGAAAAGAACGC
CCTATATCATTAGGAATTTTCCCATTACCTGCTGGAGATGGATTGCTTACACCTGATGCT
CAGAAAGGAGGAGAGACCCCTGGATCTGAGCAATGGAAATTTCAGGAATTAAGTCAACCA
CGTTCTCATACCAGCCTGAAGGATGAGCTTTCTGATGTTAGCCAAGGCGGATCTAAAGCT
ACCACTCCAGCATCAACAGCTAATTCAGATGTGGCAACAATTCCTACTGATACTCCCTTA
AAGGAAGAAAACGAAGGATTTGTGAAGGTTACAGATGCGCCAAATAAATCAGAGATAAGC
AAACACATTGAAGTACAGGTAGCCCAGGAAACTAGAAATGTATCTACTGGCTCTGCTGAA
AATGAAGAAAAGTCAGAAGTTCAAGCAATCATCGAATCTACTCCTGAGCTGGATATGGAC
AAAGATCTCAGTGGATATAAAGGTTCAAGCACTCCCACCAAAGGCATAGAGAACAAAGCT
TTTGATCGCAATACAGAATCTCTCTTTGAAGAACTGTCTTCAGCTGGCTCAGGCCTAATA
GGAGATGTGGATGAAGGAGCAGATTTACTAGGAATGGGTCGGGAAGTTGAGAATCTTATA
TTAGAAAATACACAACTGTTGGAAACCAAAAATGCTTTGAACATAGTGAAGAATGATTTG
ATAGCAAAAGTGGATGAACTGACCTGTGAGAAAGATGTGCTGCAAGGGGAATTGGAGGCT
GTGAAGCAAGCCAAACTGAAACTAGAGGAAAAGAACAGAGAATTGGAGGAAGAGCTTAGG
AAAGCTCGGGCAGAAGCTGAAGATGCAAGGCAAAAAGCAAAAGATGACGATGATAGTGAT
ATTCCCACAGCCCAGAGGAAACGGTTTACTAGAGTAGAAATGGCCCGTGTTCTCATGGAG
CGAAACCAGTATAAAGAGAGATTGATGGAGCTTCAGGAAGCTGTTCGATGGACAGAGATG
ATTCGGGCATCACGAGAAAATCCAGCCATGCAGGAAAAAAAAAGGTCAAGCATTTGGCAG
TTTGTGCCAACTCGTTTCAGCCGACTTTTCAGCTCCTCAAGTAACACGACTAAGAAGCCT
GAACCACCTGTTAATCTGAAGTACAATGCACCCACGTCTCATGTTACTCCGTCCGTCAAG
AAAAGAAGCAGCACCTTATCTCAGCTCCCTGGGGATAAGTCCAAAGCCTTTGATTTCCTT
AGTGAAGAAACTGAAGCTAGTTTAGCCTCACGCAGAGAACAAAAGAGAGAGCAGTATCGT
CAGGTAAAAGCACATGTTCAGAAGGAAGACGGTAGAGTGCAGGCTTTTGGCTGGAGTCTG
CCTCAGAAGTACAAACAGGTAACCAATGGTCAAGGTGAAAATAAGATGAAAAATTTACCT
GTGCCTGTCTATCTCAGACCTCTGGATGAAAAAGATACATCAATGAAGCTGTGGTGTGCT
GTTGGAGTCAATTTATCTGGTGGGAAGACCAGAGATGGTGGTTCTGTTGTTGGAGCAAGT
GTATTTTACAAGGATGTTGCTGGTTTGGATACAGAAGGCAGTAAACAGCGAAGTGCCTCT
CAGAGTAGTTTAGATAAGTTAGATCAGGAACTTAAGGAACAGCAGAAGGAGTTAAAAAAT
CAAGAAGAATTATCCAGTCTAGTTTGGATCTGTACCAGCACTCATTCGGCTACAAAAGTT
CTTATTATTGATGCTGTTCAACCTGGCAACATCCTAGACAGTTTCACTGTTTGCAACTCT
CATGTTCTGTGCATTGCAAGTGTGCCAGGTGCACGAGAAACAGACTACCCTGCAGGAGAA
GATCTTTCAGAATCTGGTCAGGTAGACAAAGCATCTTTATGTGGAAGTATGACAAGCAAC
AGCTCAGCAGAGACAGACAGCCTGTTAGGAGGCATCACAGTGGTTGGTTGTTCTGCAGAA
GGTGTGACGGGAGCTGCCACTTCCCCTAGTACAAATGGTGCTTCTCCAGTGATGGATAAA
CCACCAGAAATGGAAGCAGAAAATAGTGAGGTTGATGAAAATGTTCCAACAGCAGAAGAA
GCAACTGAAGCTACAGAAGGGAATGCGGGGTCAGCTGAAGACACAGTGGACATCTCCCAA
ACTGGCGTCTACACAGAGCATGTCTTTACAGATCCTTTGGGAGTTCAGATCCCAGAAGAC
CTCTCCCCAGTGTATCAGTCGAGCAATGACTCAGATGCATATAAAGATCAAATATCAGTA
CTGCCAAATGAACAAGACTTGGTGAGAGAAGAAGCCCAGAAAATGAGTAGTCTTTTACCA
ACTATGTGGCTTGGAGCTCAAAATGGCTGTTTGTATGTCCATTCATCTGTAGCCCAGTGG
AGGAAATGTCTCCATTCCATTAAACTTAAAGATTCGATTCTCAGTATTGTACACGTGAAG
GGAATCGTGTTAGTAGCCCTGGCTGACGGCACCCTTGCAATCTTTCACAGAGGAGTGGAT
GGGCAGTGGGATTTGTCAAACTATCACCTCTTAGACCTTGGACGGCCTCATCATTCCATC
CGTTGCATGACTGTGGTACATGACAAAGTCTGGTGTGGCTATAGGAACAAAATCTATGTG
GTGCAGCCAAAGGCCATGAAAATAGAGAAATCTTTTGATGCACATCCCAGGAAGGAGAGC
CAAGTGCGACAGCTTGCGTGGGTGGGGGATGGCGTGTGGGTCTCCATTCGCTTGGATTCT
ACGCTCCGTCTCTATCATGCACACACTTATCAACATCTACAGGATGTGGACATTGAGCCT
TATGTAAGCAAAATGTTAGGTACTGGAAAACTGGGCTTCTCTTTTGTGAGAATTACAGCT
CTTATGGTGTCTTGTAATCGTTTGTGGGTGGGGACAGGAAATGGTGTCATTATCTCCATC
CCATTGACAGAAACAAATAAAACCTCAGGTGTACCAGGAAATCGTCCTGGAAGTGTAATC
CGTGTATATGGTGATGAAAACAGTGATAAAGTGACTCCAGGGACATTTATACCCTATTGT
TCAATGGCACATGCACAGCTTTGCTTCCATGGGCACCGGGATGCTGTGAAATTCTTTGTG
GCAGTCCCAGGTCAAGTCATCAGCCCACAAAGTAGCAGTAGTGGCACGGATCTGACGGGT
GACAAAGCAGGGCCATCTGCACAGGAGCCTGGTAGTCAGACGCCCTTGAAGTCTATGCTT
GTCATCAGTGGAGGAGAGGGCTACATCGACTTCCGAATGGGTGATGAAGGTGGAGAATCA
GAACTTCTTGGAGAGGATCTTCCACTTGAACCTTCTGTCACCAAAGCAGAAAGGAGTCAC
TTGATAGTGTGGCAAGTGATGTATGGCAATGAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:14524
Chromosome Location17
LocusNot Available
References
  1. Lee CM, Onesime D, Reddy CD, Dhanasekaran N, Reddy EP: JLP: A scaffolding protein that tethers JNK/p38MAPK signaling modules and transcription factors. Proc Natl Acad Sci U S A. 2002 Oct 29;99(22):14189-94. Epub 2002 Oct 21. 12391307
  2. Guinn BA, Bland EA, Lodi U, Liggins AP, Tobal K, Petters S, Wells JW, Banham AH, Mufti GJ: Humoral detection of leukaemia-associated antigens in presentation acute myeloid leukaemia. Biochem Biophys Res Commun. 2005 Oct 7;335(4):1293-304. 16112646
  3. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. 9628581
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. 12168954
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Shankar S, Mohapatra B, Suri A: Cloning of a novel human testis mRNA specifically expressed in testicular haploid germ cells, having unique palindromic sequences and encoding a leucine zipper dimerization motif. Biochem Biophys Res Commun. 1998 Feb 13;243(2):561-5. 9480848
  9. Yasuoka H, Ihn H, Medsger TA Jr, Hirakata M, Kawakami Y, Ikeda Y, Kuwana M: A novel protein highly expressed in testis is overexpressed in systemic sclerosis fibroblasts and targeted by autoantibodies. J Immunol. 2003 Dec 15;171(12):6883-90. 14662895
  10. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. 15144186
  11. Bouwmeester T, Bauch A, Ruffner H, Angrand PO, Bergamini G, Croughton K, Cruciat C, Eberhard D, Gagneur J, Ghidelli S, Hopf C, Huhse B, Mangano R, Michon AM, Schirle M, Schlegl J, Schwab M, Stein MA, Bauer A, Casari G, Drewes G, Gavin AC, Jackson DB, Joberty G, Neubauer G, Rick J, Kuster B, Superti-Furga G: A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway. Nat Cell Biol. 2004 Feb;6(2):97-105. Epub 2004 Jan 25. 14743216
  12. Jagadish N, Rana R, Selvi R, Mishra D, Garg M, Yadav S, Herr JC, Okumura K, Hasegawa A, Koyama K, Suri A: Characterization of a novel human sperm-associated antigen 9 (SPAG9) having structural homology with c-Jun N-terminal kinase-interacting protein. Biochem J. 2005 Jul 1;389(Pt 1):73-82. 15693750
  13. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  14. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. 17525332
  15. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  16. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  17. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  18. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  19. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  20. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  21. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  22. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  24. Isabet T, Montagnac G, Regazzoni K, Raynal B, El Khadali F, England P, Franco M, Chavrier P, Houdusse A, Menetrey J: The structural basis of Arf effector specificity: the crystal structure of ARF6 in a complex with JIP4. EMBO J. 2009 Sep 16;28(18):2835-45. doi: 10.1038/emboj.2009.209. Epub 2009 Jul 30. 19644450