You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLysine-specific histone demethylase 1A
Synonyms
  • 1.-.-.-
  • AOF2
  • BRAF35-HDAC complex protein BHC110
  • Flavin-containing amine oxidase domain-containing protein 2
  • KDM1
  • KIAA0601
  • LSD1
Gene NameKDM1A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009316|Lysine-specific histone demethylase 1A
MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
Number of residues852
Molecular Weight92901.905
Theoretical pINot Available
GO Classification
Functions
  • histone demethylase activity (H3-dimethyl-K4 specific)
  • histone demethylase activity (H3-K4 specific)
  • transcription factor activity, sequence-specific DNA binding
  • MRF binding
  • oxidoreductase activity
  • demethylase activity
  • chromatin binding
  • androgen receptor binding
  • transcription factor binding
  • ligand-dependent nuclear receptor transcription coactivator activity
  • enzyme binding
  • transcription regulatory region DNA binding
  • histone demethylase activity (H3-K9 specific)
  • p53 binding
  • flavin adenine dinucleotide binding
  • histone demethylase activity
Processes
  • histone H3-K4 demethylation
  • regulation of transcription from RNA polymerase II promoter
  • granulocyte differentiation
  • negative regulation of sequence-specific DNA binding transcription factor activity
  • muscle cell development
  • blood coagulation
  • regulation of double-strand break repair via homologous recombination
  • negative regulation of transcription, DNA-templated
  • negative regulation of histone H3-K4 methylation
  • negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
  • positive regulation of erythrocyte differentiation
  • pituitary gland development
  • positive regulation of histone ubiquitination
  • cellular response to UV
  • positive regulation of hormone biosynthetic process
  • protein demethylation
  • positive regulation of neural precursor cell proliferation
  • regulation of primitive erythrocyte differentiation
  • small GTPase mediated signal transduction
  • cellular response to gamma radiation
  • negative regulation of histone H3-K9 methylation
  • cell proliferation
  • negative regulation of DNA binding
  • in utero embryonic development
  • histone H3-K9 demethylation
  • positive regulation of stem cell proliferation
  • negative regulation of protein binding
  • positive regulation of transcription from RNA polymerase II promoter
  • positive regulation of sequence-specific DNA binding transcription factor activity
  • negative regulation of transcription from RNA polymerase II promoter
  • regulation of cellular protein localization
  • positive regulation of megakaryocyte differentiation
  • negative regulation of DNA damage response, signal transduction by p53 class mediator
  • transcription, DNA-templated
  • chromatin organization
Components
  • nuclear chromatin
  • protein complex
  • nucleus
  • DNA repair complex
  • transcription factor complex
  • nucleoplasm
General FunctionTranscription regulatory region dna binding
Specific FunctionHistone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me. May play a role in the repression of neuronal genes. Alone, it is unable to demethylate H3K4me on nucleosomes and requires the presence of RCOR1/CoREST to achieve such activity. Also acts as a coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and mediating demethylation of H3K9me, a specific tag for epigenetic transcriptional repression. The presence of PRKCB in ANDR-containing complexes, which mediates phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag that prevents demethylation H3K4me, prevents H3K4me demethylase activity of KDM1A. Demethylates di-methylated 'Lys-370' of p53/TP53 which prevents interaction of p53/TP53 with TP53BP1 and represses p53/TP53-mediated transcriptional activation. Demethylates and stabilizes the DNA methylase DNMT1. Required for gastrulation during embryogenesis. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Effector of SNAI1-mediated transcription repression of E-cadherin/CDH1, CDN7 and KRT8. Required for the maintenance of the silenced state of the SNAI1 target genes E-cadherin/CDH1 and CDN7.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO60341
UniProtKB Entry NameKDM1A_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0017747|Lysine-specific histone demethylase 1A (KDM1A)
ATGTTATCTGGGAAGAAGGCGGCAGCCGCGGCGGCGGCGGCTGCAGCGGCAGCAACCGGG
ACGGAGGCTGGCCCTGGGACAGCAGGCGGCTCCGAGAACGGGTCTGAGGTGGCCGCGCAG
CCCGCGGGCCTGTCGGGCCCAGCCGAGGTCGGGCCGGGGGCGGTGGGGGAGCGCACACCC
CGCAAGAAAGAGCCTCCGCGGGCCTCGCCCCCCGGGGGCCTGGCGGAACCGCCGGGGTCC
GCAGGGCCTCAGGCCGGCCCTACTGTCGTGCCTGGGTCTGCGACCCCCATGGAAACTGGA
ATAGCAGAGACTCCGGAGGGGCGTCGGACCAGCCGGCGCAAGCGGGCGAAGGTAGAGTAC
AGAGAGATGGATGAAAGCTTGGCCAACCTCTCAGAAGATGAGTATTATTCAGAAGAAGAG
AGAAATGCCAAAGCAGAGAAGGAAAAGAAGCTTCCCCCACCACCCCCTCAAGCCCCACCT
GAGGAAGAAAATGAAAGTGAGCCTGAAGAACCATCGGGGCAAGCAGGAGGACTTCAAGAC
GACAGTTCTGGAGGGTATGGAGACGGCCAAGCATCAGGTGTGGAGGGCGCAGCTTTCCAG
AGCCGACTTCCTCATGACCGGATGACTTCTCAAGAAGCAGCCTGTTTTCCAGATATTATC
AGTGGACCACAACAGACCCAGAAGGTTTTTCTTTTCATTAGAAACCGCACACTGCAGTTG
TGGTTGGATAATCCAAAGATTCAGCTGACATTTGAGGCTACTCTCCAACAATTAGAAGCA
CCTTATAACAGTGATACTGTGCTTGTCCACCGAGTTCACAGTTATTTAGAGCGTCATGGT
CTTATCAACTTCGGCATCTATAAGAGGATAAAACCCCTACCAACTAAAAAGACAGGAAAG
GTAATTATTATAGGCTCTGGGGTCTCAGGCTTGGCAGCAGCTCGACAGTTACAAAGTTTT
GGAATGGATGTCACACTTTTGGAAGCCAGGGATCGTGTGGGTGGACGAGTTGCCACATTT
CGCAAAGGAAACTATGTAGCTGATCTTGGAGCCATGGTGGTAACAGGTCTTGGAGGGAAT
CCTATGGCTGTGGTCAGCAAACAAGTAAATATGGAACTGGCCAAGATCAAGCAAAAATGC
CCACTTTATGAAGCCAACGGACAAGCTGACACTGTCAAGGTTCCTAAAGAGAAAGATGAA
ATGGTAGAGCAAGAGTTTAACCGGTTGCTAGAAGCTACATCTTACCTTAGTCATCAACTA
GACTTCAATGTCCTCAATAATAAGCCTGTGTCCCTTGGCCAGGCATTGGAAGTTGTCATT
CAGTTACAAGAGAAGCATGTCAAAGATGAGCAGATTGAACATTGGAAGAAGATAGTGAAA
ACTCAGGAAGAATTGAAAGAACTTCTTAATAAGATGGTAAATTTGAAAGAGAAAATTAAA
GAACTCCATCAGCAATACAAAGAAGCATCTGAAGTAAAGCCACCCAGAGATATTACTGCC
GAGTTCTTAGTGAAAAGCAAACACAGGGATCTGACCGCCCTATGCAAGGAATATGATGAA
TTAGCTGAAACACAAGGAAAGCTAGAAGAAAAACTTCAGGAGTTGGAAGCGAATCCCCCA
AGTGATGTATATCTCTCATCAAGAGACAGACAAATACTTGATTGGCATTTTGCAAATCTT
GAATTTGCTAATGCCACACCTCTCTCAACTCTCTCCCTTAAGCACTGGGATCAGGATGAT
GACTTTGAGTTCACTGGCAGCCACCTGACAGTAAGGAATGGCTACTCGTGTGTGCCTGTG
GCTTTAGCAGAAGGCCTAGACATTAAACTGAATACAGCAGTGCGACAGGTTCGCTACACG
GCTTCAGGATGTGAAGTGATAGCTGTGAATACCCGCTCCACGAGTCAAACCTTTATTTAT
AAATGCGACGCAGTTCTCTGTACCCTTCCCCTGGGTGTGCTGAAGCAGCAGCCACCAGCC
GTTCAGTTTGTGCCACCTCTCCCTGAGTGGAAAACATCTGCAGTCCAAAGGATGGGATTT
GGCAACCTTAACAAGGTGGTGTTGTGTTTTGATCGGGTGTTCTGGGATCCAAGTGTCAAT
TTGTTCGGGCATGTTGGCAGTACGACTGCCAGCAGGGGTGAGCTCTTCCTCTTCTGGAAC
CTCTATAAAGCTCCAATACTGTTGGCACTAGTGGCAGGAGAAGCTGCTGGTATCATGGAA
AACATAAGTGACGATGTGATTGTTGGCCGATGCCTGGCCATTCTCAAAGGGATTTTTGGT
AGCAGTGCAGTACCTCAGCCCAAAGAAACTGTGGTGTCTCGTTGGCGTGCTGATCCCTGG
GCTCGGGGCTCTTATTCCTATGTTGCTGCAGGATCATCTGGAAATGACTATGATTTAATG
GCTCAGCCAATCACTCCTGGCCCCTCGATTCCAGGTGCCCCACAGCCGATTCCACGACTC
TTCTTTGCGGGAGAACATACGATCCGTAACTACCCAGCCACAGTGCATGGTGCTCTGCTG
AGTGGGCTGCGAGAAGCGGGAAGAATTGCAGACCAGTTTTTGGGGGCCATGTATACGCTG
CCTCGCCAGGCCACACCAGGTGTTCCTGCACAGCAGTCCCCAAGCATGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29079
Chromosome Location1
LocusNot Available
References
  1. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. 9628581
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R: A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7420-5. 12032298
  6. Humphrey GW, Wang Y, Russanova VR, Hirai T, Qin J, Nakatani Y, Howard BH: Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1. J Biol Chem. 2001 Mar 2;276(9):6817-24. Epub 2000 Dec 1. 11102443
  7. Hakimi MA, Dong Y, Lane WS, Speicher DW, Shiekhattar R: A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes. J Biol Chem. 2003 Feb 28;278(9):7234-9. Epub 2002 Dec 18. 12493763
  8. Shi Y, Lan F, Matson C, Mulligan P, Whetstine JR, Cole PA, Casero RA, Shi Y: Histone demethylation mediated by the nuclear amine oxidase homolog LSD1. Cell. 2004 Dec 29;119(7):941-53. 15620353
  9. Forneris F, Binda C, Vanoni MA, Mattevi A, Battaglioli E: Histone demethylation catalysed by LSD1 is a flavin-dependent oxidative process. FEBS Lett. 2005 Apr 11;579(10):2203-7. 15811342
  10. Shi YJ, Matson C, Lan F, Iwase S, Baba T, Shi Y: Regulation of LSD1 histone demethylase activity by its associated factors. Mol Cell. 2005 Sep 16;19(6):857-64. 16140033
  11. Lee MG, Wynder C, Cooch N, Shiekhattar R: An essential role for CoREST in nucleosomal histone 3 lysine 4 demethylation. Nature. 2005 Sep 15;437(7057):432-5. Epub 2005 Aug 3. 16079794
  12. Metzger E, Wissmann M, Yin N, Muller JM, Schneider R, Peters AH, Gunther T, Buettner R, Schule R: LSD1 demethylates repressive histone marks to promote androgen-receptor-dependent transcription. Nature. 2005 Sep 15;437(7057):436-9. Epub 2005 Aug 3. 16079795
  13. Forneris F, Binda C, Vanoni MA, Battaglioli E, Mattevi A: Human histone demethylase LSD1 reads the histone code. J Biol Chem. 2005 Dec 16;280(50):41360-5. Epub 2005 Oct 13. 16223729
  14. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  15. Huang J, Sengupta R, Espejo AB, Lee MG, Dorsey JA, Richter M, Opravil S, Shiekhattar R, Bedford MT, Jenuwein T, Berger SL: p53 is regulated by the lysine demethylase LSD1. Nature. 2007 Sep 6;449(7158):105-8. 17805299
  16. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  17. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  18. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  19. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  20. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  21. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  22. Lee SW, Cho YS, Na JM, Park UH, Kang M, Kim EJ, Um SJ: ASXL1 represses retinoic acid receptor-mediated transcription through associating with HP1 and LSD1. J Biol Chem. 2010 Jan 1;285(1):18-29. doi: 10.1074/jbc.M109.065862. Epub 2009 Oct 31. 19880879
  23. Metzger E, Imhof A, Patel D, Kahl P, Hoffmeyer K, Friedrichs N, Muller JM, Greschik H, Kirfel J, Ji S, Kunowska N, Beisenherz-Huss C, Gunther T, Buettner R, Schule R: Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4. Nature. 2010 Apr 1;464(7289):792-6. doi: 10.1038/nature08839. Epub 2010 Mar 14. 20228790
  24. Lin T, Ponn A, Hu X, Law BK, Lu J: Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Oncogene. 2010 Sep 2;29(35):4896-904. doi: 10.1038/onc.2010.234. Epub 2010 Jun 21. 20562920
  25. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  26. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  27. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  28. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  29. Yang M, Gocke CB, Luo X, Borek D, Tomchick DR, Machius M, Otwinowski Z, Yu H: Structural basis for CoREST-dependent demethylation of nucleosomes by the human LSD1 histone demethylase. Mol Cell. 2006 Aug 4;23(3):377-87. 16885027
  30. Chen Y, Yang Y, Wang F, Wan K, Yamane K, Zhang Y, Lei M: Crystal structure of human histone lysine-specific demethylase 1 (LSD1). Proc Natl Acad Sci U S A. 2006 Sep 19;103(38):13956-61. Epub 2006 Sep 6. 16956976
  31. Tochio N, Umehara T, Koshiba S, Inoue M, Yabuki T, Aoki M, Seki E, Watanabe S, Tomo Y, Hanada M, Ikari M, Sato M, Terada T, Nagase T, Ohara O, Shirouzu M, Tanaka A, Kigawa T, Yokoyama S: Solution structure of the SWIRM domain of human histone demethylase LSD1. Structure. 2006 Mar;14(3):457-68. 16531230