You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCalcium-transporting ATPase type 2C member 2
Synonyms
  • 3.6.3.8
  • ATPase 2C2
  • KIAA0703
  • Secretory pathway Ca(2+)-ATPase 2
  • SPCA2
Gene NameATP2C2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008782|Calcium-transporting ATPase type 2C member 2
MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKC
QKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLG
SALVSVLTKEYEDAVSIATAVLVVVTVAFIQEYRSEKSLEELTKMVPPECNCLREGKLQH
LLARELVPGDVVSLSIGDRIPADIRLTEVTDLLVDESSFTGEAEPCSKTDSPLTGGGDLT
TLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAEETPKTPLQKSMDRLGKQLTL
FSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLGVLRMAKKRVI
VKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS
KEVIKEFSNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRK
KEIPFSSEQKWMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFC
LQEEKRMGSLGLRVLALASGPELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMIT
GDALETALAIGRNIGLCNGKLQAMSGEEVDSVEKGELADRVGKVSVFFRTSPKHKLKIIK
ALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSKEAANMILVDDDFSAIMNAVE
EGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINIIMDGPPAQSLG
VEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFWKEMPEDRASTPRTTT
MTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQ
TENLGALDLLFLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV
Number of residues946
Molecular Weight103186.475
Theoretical pINot Available
GO Classification
Functions
  • manganese-transporting ATPase activity
  • ATP binding
  • calcium-transporting ATPase activity
  • metal ion binding
Processes
  • transmembrane transport
  • ion transmembrane transport
  • calcium ion transmembrane transport
  • cellular calcium ion homeostasis
  • manganese ion transmembrane transport
Components
  • integral component of plasma membrane
  • Golgi membrane
General FunctionMetal ion binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.
Pfam Domain Function
Transmembrane Regions107-127 130-150 232-252 294-314 332-352 751-771 805-825 838-855 875-895 906-926
GenBank Protein IDNot Available
UniProtKB IDO75185
UniProtKB Entry NameAT2C2_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013412|Calcium-transporting ATPase type 2C member 2 (ATP2C2)
ATGGTCGAGGGACGCGTCTCCGAGTTCCTGAAGAAACTCGGCTTCTCGGGCGGGGGCCGC
CAGTACCAGGCGCTGGAGAAGGACGAAGAGGAAGCCTTGATTGATGAACAGAGTGAGCTG
AAAGCCATCGAGAAAGAGAAGAAGGTGACAGCCCTGCCCCCCAAGGAAGCGTGCAAATGC
CAGAAAGAGGATTTGGCCAGAGCGTTTTGTGTGGACTTACACACTGGGCTGTCGGAGTTC
TCGGTGACGCAGCGCCGGCTGGCCCATGGCTGGAATGAGTTTGTTGCTGACAACAGCGAA
CCTGTGTGGAAGAAATACCTGGATCAGTTTAAGAACCCCCTGATCCTGCTGCTGCTGGGC
TCTGCCCTGGTGAGTGTCCTCACCAAGGAGTATGAGGACGCCGTCAGCATCGCCACGGCA
GTGCTTGTCGTGGTCACTGTCGCCTTCATCCAGGAGTACAGGTCGGAGAAATCTCTGGAA
GAGCTGACCAAGCTGGTTCCTCCAGAATGTAACTGCCTAAGAGAAGGAAAACTCCAGCAC
CTGCTTGCTCGAGAACTGGTTCCTGGTGATGTCGTATCTCTCTCGATCGGAGACCGGATC
CCTGCAGACATCCGACTCACTGAGGTCACGGACCTCTTGGTGGATGAATCCAGTTTCACC
GGGGAAGCCGAGCCATGTAGTAAAACAGACAGCCCCTTGACAGGCGGTGGGGACCTCACC
ACCCTCAGCAACATCGTCTTCATGGGGACCCTGGTGCAGTATGGGAGGGGCCAGGGGGTC
GTGATTGGAACAGGGGAAAGCTCTCAGTTCGGAGAAGTGTTTAAGATGATGCAGGCTGAA
GAGACACCTAAAACTCCTTTGCAGAAAAGCATGGACAGGCTAGGAAAGCAACTGACACTC
TTCTCCTTTGGCATAATCGGTCTCATCATGCTCATTGGCTGGTCGCAAGGGAAACAACTC
CTGAGTATGTTCACGATCGGGGTCAGCCTGGCTGTGGCGGCCATTCCAGAGGGTCTGCCC
ATCGTCGTCATGGTGACGCTGGTCCTGGGAGTGCTGCGGATGGCCAAGAAGCGGGTCATC
GTGAAGAAGTTACCCATCGTGGAGACTTTAGGTTGCTGCAGCGTTCTCTGTTCTGACAAG
ACGGGGACTCTGACTGCCAATGAAATGACAGTGACCCAGCTTGTAACGTCAGATGGGCTT
CGTGCCGAGGTCAGCGGAGTTGGGTATGACGGTCAAGGGACTGTGTGTCTTCTACCATCC
AAGGAAGTCATTAAGGAATTTTCCAATGTCTCAGTGGGAAAGTTAGTGGAGGCGGGCTGT
GTTGCCAACAATGCGGTCATCAGAAAGAACGCCGTGATGGGGCAGCCCACCGAGGGTGCA
TTGATGGCCCTGGCGATGAAGATGGACTTAAGTGATATTAAAAATTCATATATAAGAAAA
AAAGAGATTCCATTCAGTTCAGAGCAGAAGTGGATGGCGGTGAAATGCAGTCTGAAGACT
GAGGATCAGGAAGACATTTACTTCATGAAAGGGGCCTTGGAAGAGGTGATCCGCTACTGC
ACCATGTACAACAACGGGGGCATCCCCCTGCCGCTGACGCCCCAGCAGAGGTCATTCTGC
CTGCAGGAAGAGAAGAGGATGGGGTCGCTCGGTTTGCGGGTGCTGGCCCTGGCTTCTGGG
CCCGAGCTGGGGCGGCTGACGTTTCTCGGTCTTGTGGGCATCATTGACCCCCCGAGAGTT
GGCGTGAAGGAAGCAGTCCAGGTTCTCTCCGAGTCTGGTGTGTCTGTGAAGATGATAACG
GGGGATGCCCTGGAGACGGCCTTGGCCATAGGAAGAAACATCGGCCTGTGCAACGGGAAG
CTGCAAGCCATGTCCGGGGAGGAGGTGGACAGCGTGGAGAAGGGCGAGCTGGCCGACCGC
GTGGGGAAGGTGTCCGTGTTCTTCAGGACCAGCCCAAAGCACAAGCTCAAAATCATCAAG
GCTCTGCAGGAGTCAGGGGCGATCGTGGCCATGACTGGGGATGGGGTGAACGACGCAGTG
GCCCTGAAGTCTGCAGACATTGGGATCGCCATGGGGCAGACAGGGACGGACGTCAGCAAA
GAGGCCGCCAACATGATCCTGGTGGATGATGACTTCTCAGCCATCATGAATGCAGTGGAG
GAAGGCAAGGGTATTTTTTACAACATCAAAAACTTTGTCCGATTCCAGCTGAGCACGAGC
ATCTCCGCCCTGAGTCTCATCACTCTGTCCACCGTGTTCAACCTGCCCAGCCCCCTCAAC
GCCATGCAGATCCTATGGATCAACATCATCATGGATGGGCCACCGGCGCAGAGGAGTTCC
CAGAAAACTGAAGTGTGTTGCACTGCAGTGAGACTGGGAGTAGAAGGCAGAGGAGAAAGT
ACCTGGGCCGGCAGAGCTGGCTTGGGGGTAGAGCCCGTTGACAAAGACGCCTTCAGGCAG
CCACCACGGAGTGTGCGGGACACCATCCTCAGCAGAGCCCTCATCCTGAAGATCCTCATG
TCCGCGGCCATCATCATCAGCGGGACCCTCTTTATCTTCTGGAAGGAGATGCCTGAAGAC
AGAGCAAGCACTCCCCGCACCACGACGATGACGTTCACTTGTTTTGTGTTTTTCGATCTC
TTCAACGCCTTGACCTGCCGCTCTCAGACCAAGCTGATATTTGAGATCGGCTTTCTCAGG
AACCACATGTTCCTCTACTCCGTCCTGGGGTCCATCCTGGGGCAGCTGGCGGTCATTTAC
ATCCCCCCGCTGCAGAGGGTCTTCCAGACGGAGAACCTGGGAGCGCTTGATTTGCTGTTT
TTAACTGGATTGGCCTCATCCGTCTTCATTTTGTCAGAGCTCCTCAAACTATGTGAAAAA
TACTGTTGCAGCCCCAAGAGAGTCCAGATGCACCCTGAAGATGTGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29103
Chromosome Location16
LocusNot Available
References
  1. Vanoevelen J, Dode L, Van Baelen K, Fairclough RJ, Missiaen L, Raeymaekers L, Wuytack F: The secretory pathway Ca2+/Mn2+-ATPase 2 is a Golgi-localized pump with high affinity for Ca2+ ions. J Biol Chem. 2005 Jun 17;280(24):22800-8. Epub 2005 Apr 14. 15831496
  2. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. 9734811
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. 15616553
  6. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648