You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCytosolic 10-formyltetrahydrofolate dehydrogenase
Synonyms
  • 1.5.1.6
  • 10-FTHFDH
  • Aldehyde dehydrogenase family 1 member L1
  • FTHFD
Gene NameALDH1L1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001858|Cytosolic 10-formyltetrahydrofolate dehydrogenase
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
LASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKI
SARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGATLVCGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
Number of residues902
Molecular Weight98828.505
Theoretical pI5.76
GO Classification
Functions
  • catalytic activity
  • methyltransferase activity
  • hydroxymethyl-, formyl- and related transferase activity
  • formyltetrahydrofolate dehydrogenase activity
  • aldehyde dehydrogenase (NAD) activity
Processes
  • one-carbon metabolic process
  • biosynthetic process
  • 10-formyltetrahydrofolate catabolic process
Components
  • cytoplasm
  • mitochondrion
  • extracellular exosome
General FunctionMethyltransferase activity
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID3560541
UniProtKB IDO75891
UniProtKB Entry NameAL1L1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010656|Cytosolic 10-formyltetrahydrofolate dehydrogenase (ALDH1L1)
ATGGCAGGTCCTTCCAACCCTCCTGCTACCATGAAGATTGCAGTGATTGGACAGAGCCTG
TTTGGCCAGGAAGTTTACTGCCACCTGAGGAAGGAGGGCCACGAAGTGGTGGGTGTGTTC
ACTGTTCCAGACAAGGATGGAAAGGCCGACCCCCTGGGTCTGGAAGCTGAGAAGGATGGA
GTGCCGGTATTCAAGTACTCCCGGTGGCGTGCAAAAGGACAGGCTTTGCCTGATGTGGTG
GCAAAATACCAGGCTTTGGGGGCCGAGCTCAACGTCCTGCCCTTCTGCAGCCAATTCATC
CCCATGGAGATAATCAGTGCCCCCCGGCATGGCTCCATCATCTATCACCCGTCACTGCTC
CCTAGGCACCGAGGGGCCTCGGCCATCAACTGGACCCTCATTCACGGAGATAAGAAAGGG
GGGTTTTCCATCTTCTGGGCGGATGATGGTCTGGACACCGGAGACCTGCTGCTGCAGAAG
GAGTGTGAGGTGCTCCCGGACGACACCGTGAGCACGCTGTACAACCGCTTCCTCTTCCCT
GAAGGCATCAAAGGGATGGTGCAGGCCGTGAGGCTGATCGCTGAGGGCAAAGCCCCCAGA
CTCCCTCAGCCTGAGGAAGGAGCCACCTATGAGGGGATTCAGAAGAAGGAGACAGCCAAG
ATCAACTGGGACCAGCCGGCAGAGGCCATTCACAACTGGATCCGCGGGAACGACAAGGTG
CCGGGAGCCTGGACAGAGGCCTGTGAACAGAAACTGACATTTTTCAACTCAACGCTGAAC
ACTTCAGGCCTGGTGCCCGAGGGAGACGCTTTGCCCATCCCAGGAGCCCATCGGCCAGGG
GTGGTCACCAAAGCAGGACTCATCCTCTTTGGGAATGATGACAAAATGCTGCTGGTGAAG
AATATTCAGCTGGAGGATGGCAAAATGATCCTGGCCTCGAACTTCTTTAAGGGGGCAGCC
AGCAGTGTCCTTGAGCTGACAGAGGCAGAGCTGGTTACTGCGGAGGCTGTGCGGAGTGTT
TGGCAGCGGATCCTCCCCAAAGTCCTGGAGGTTGAAGACTCCACTGATTTCTTCAAGTCA
GGGGCCGCGTCTGTGGACGTTGTGAGGCTGGTGGAGGAAGTGAAGGAGCTGTGTGATGGC
CTGGAGTTAGAAAATGAAGATGTGTACATGGCATCCACCTTTGGGGACTTCATCCAGCTG
TTAGTGAGGAAGCTGCGAGGGGACGATGAGGAGGGCGAGTGCAGCATTGACTACGTGGAA
ATGGCAGTGAACAAGCGCACTGTCCGCATGCCCCACCAGCTCTTCATTGGGGGGGAGTTC
GTGGATGCCGAGGGCGCCAAGACCTCTGAGACCATCAATCCCACCGATGGAAGTGTCATC
TGCCAGGTATCCCTGGCCCAAGTCACCGACGTCGACAAGGCAGTGGCCGCAGCCAAGGAT
GCCTTTGAGAATGGACGGTGGGGGAAGATCAGTGCGCGGGACCGGGGCCGGCTGATGTAC
AGGTTGGCAGATCTCATGGAGCAGCACCAGGAGGAGCTGGCCACCATTGAGGCCCTGGAT
GCGGGTGCCGTCTACACGCTGGCCCTGAAGACCCACGTGGGCATGTCCATCCAGACCTTC
CGCTACTTTGCTGGCTGGTGTGACAAGATCCAGGGCTCCACCATCCCCATCAACCAGGCC
AGACCCAACCGCAACCTGACCTTGACCAGGAAGGAGCCTGTTGGGGTTTGTGGCATCATC
ATCCCCTGGAACTATCCCCTGATGATGCTGTCCTGGAAGACAGCTGCCTGCCTGGCTGCC
GGGAACACAGTGGTGATCAAGCCTGCTCAGGTGACCCCACTCACAGCCTTGAAGTTTGCA
GAGCTGACATTAAAGGCCGGCATTCCCAAAGGTGTGGTTAACGTCCTCCCAGGATCTGGC
TCCCTGGTCGGCCAGAGACTCTCAGACCATCCTGATGTGAGGAAAATCGGGTTCACAGGC
TCCACAGAGGTGGGCAAGCACATCATGAAAAGCTGTGCCATAAGTAACGTGAAGAAGGTG
TCCCTGGAACTGGGCGGGAAGTCACCCCTCATCATCTTTGCTGACTGTGACCTCAACAAG
GCTGTGCAGATGGGGATGAGTTCTGTTTTCTTCAACAAAGGAGAGAATTGCATTGCAGCA
GGCCGACTCTTTGTGGAGGACTCCATTCATGATGAGTTCGTGCGGAGAGTGGTAGAAGAG
GTGCGGAAGATGAAGGTGGGCAACCCGCTGGACAGGGACACCGACCACGGGCCGCAGAAT
CACCATGCCCACCTTGTGAAGCTGATGGAGTACTGCCAGCATGGCGTGAAGGAAGGGGCC
ACACTGGTCTGCGGCGGGAATCAGGTCCCTCGGCCAGGGTTCTTCTTTGAGCCAACTGTT
TTCACAGACGTGGAAGACCACATGTTCATAGCCAAGGAGGAGTCCTTCGGGCCTGTCATG
ATCATCTCTCGGTTTGCTGATGGGGACTTGGATGCCGTGCTGTCTCGGGCCAATGCCACG
GAATTTGGCCTGGCTTCTGGTGTCTTCACCAGGGACATCAACAAGGCCCTGTATGTCAGT
GACAAGCTCCAGGCAGGCACTGTGTTTGTCAACACGTACAACAAGACCGACGTGGCCGCT
CCCTTCGGAGGATTCAAACAGTCTGGATTTGGCAAAGATCTAGGAGAGGCGGCTCTGAAC
GAGTACCTGCGGGTCAAGACAGTGACCTTCGAATACTGA
GenBank Gene IDAF052732
GeneCard IDNot Available
GenAtlas IDALDH1L1
HGNC IDHGNC:3978
Chromosome Location3
Locus3q21.2
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. 16641997
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Krupenko NI, Dubard ME, Strickland KC, Moxley KM, Oleinik NV, Krupenko SA: ALDH1L2 is the mitochondrial homolog of 10-formyltetrahydrofolate dehydrogenase. J Biol Chem. 2010 Jul 23;285(30):23056-63. doi: 10.1074/jbc.M110.128843. Epub 2010 May 24. 20498374
  6. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  7. Kursula P, Schuler H, Flodin S, Nilsson-Ehle P, Ogg DJ, Savitsky P, Nordlund P, Stenmark P: Structures of the hydrolase domain of human 10-formyltetrahydrofolate dehydrogenase and its complex with a substrate analogue. Acta Crystallogr D Biol Crystallogr. 2006 Nov;62(Pt 11):1294-9. Epub 2006 Oct 18. 17057331
  8. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974