You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAquaporin-8
Synonyms
  • AQP-8
Gene NameAQP8
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020826|Aquaporin-8
MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENG
TDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLG
GMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEK
TKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLL
VGLLIRCFIGDGKTRLILKAR
Number of residues261
Molecular Weight27381.01
Theoretical pINot Available
GO Classification
Functions
  • glycerol channel activity
  • water channel activity
Processes
  • response to reactive oxygen species
  • cellular water homeostasis
  • glycerol transport
  • transport
  • transmembrane transport
  • ion transmembrane transport
  • water transport
  • cellular response to cAMP
  • canalicular bile acid transport
Components
  • intracellular canaliculus
  • plasma membrane
  • integral component of plasma membrane
  • intracellular membrane-bounded organelle
  • apical part of cell
General FunctionWater channel activity
Specific FunctionForms a water-specific channel; mercury-sensitive. Not permeable to glycerol or urea.
Pfam Domain Function
Transmembrane Regions37-57 85-105 108-128 157-177 184-204 229-249
GenBank Protein IDNot Available
UniProtKB IDO94778
UniProtKB Entry NameAQP8_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0020827|Aquaporin-8 (AQP8)
ATGTCTGGAGAGATAGCCATGTGTGAGCCTGAATTTGGCAATGACAAGGCCAGGGAGCCG
AGCGTGGGTGGCAGGTGGCGAGTGTCCTGGTACGAACGGTTTGTGCAGCCATGTCTGGTC
GAACTGCTGGGCTCTGCTCTCTTCATCTTCATCGGGTGCCTGTCGGTCATTGAGAATGGG
ACGGACACTGGGCTGCTGCAGCCGGCCCTGGCCCACGGGCTGGCTTTGGGGCTCGTGATT
GCCACGCTGGGGAATATCAGTGGTGGACACTTCAACCCTGCGGTGTCCCTGGCAGCCATG
CTGATCGGAGGCCTCAACCTGGTGATGCTCCTCCCGTACTGGGTCTCACAGCTGCTCGGG
GGGATGCTCGGGGCTGCCTTGGCCAAGGCGGTGAGTCCTGAGGAGAGGTTCTGGAATGCA
TCTGGGGCGGCCTTTGTGACAGTCCAGGAGCAGGGGCAGGTGGCAGGGGCGTTGGTGGCA
GAGATCATCCTGACGACGCTGCTGGCCCTGGCTGTATGCATGGGTGCCATCAATGAGAAG
ACAAAGGGCCCTCTGGCCCCGTTCTCCATCGGCTTTGCCGTCACCGTGGATATCCTGGCT
GGGGGCCCTGTGTCTGGAGGCTGCATGAATCCCGCCCGTGCTTTTGGACCTGCGGTGGTG
GCCAACCACTGGAACTTCCACTGGATCTACTGGCTGGGCCCACTCCTGGCTGGCCTGCTT
GTTGGACTGCTCATTAGGTGCTTCATTGGAGATGGGAAGACCCGCCTCATCCTGAAGGCT
CGGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:642
Chromosome Location16
LocusNot Available
References
  1. Koyama N, Ishibashi K, Kuwahara M, Inase N, Ichioka M, Sasaki S, Marumo F: Cloning and functional expression of human aquaporin8 cDNA and analysis of its gene. Genomics. 1998 Nov 15;54(1):169-72. 9806845
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974