Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSteroid hormone receptor ERR2
Synonyms
  • ERR beta-2
  • ERR-beta
  • ERRB2
  • ESRL2
  • Estrogen receptor-like 2
  • Estrogen-related receptor beta
  • NR3B2
  • Nuclear receptor subfamily 3 group B member 2
Gene NameESRRB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008769|Steroid hormone receptor ERR2
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKVGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSP
TPLNERGRQISPSTRTPGGQGKHLWLTM
Number of residues508
Molecular Weight56207.085
Theoretical pINot Available
GO Classification
Functions
  • zinc ion binding
  • steroid hormone receptor activity
  • steroid binding
  • RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding
  • transcription factor binding
  • RNA polymerase II distal enhancer sequence-specific DNA binding
  • sequence-specific DNA binding
  • transcription coactivator activity
Processes
  • regulation of transcription, DNA-templated
  • positive regulation of transcription from RNA polymerase II promoter
  • intracellular receptor signaling pathway
  • stem cell population maintenance
  • trophectodermal cell proliferation
  • trophectodermal cellular morphogenesis
  • gene expression
  • transcription initiation from RNA polymerase II promoter
Components
  • nucleus
  • nucleoplasm
General FunctionZinc ion binding
Specific FunctionNuclear receptor, may regulate ESR1 transcriptional activity. Induces the expression of PERM1 in the skeletal muscle.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDO95718
UniProtKB Entry NameERR2_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021406|Steroid hormone receptor ERR2 (ESRRB)
ATGTCCTCGGACGACAGGCACCTGGGCTCCAGCTGCGGCTCCTTCATCAAGACTGAGCCG
TCCAGCCCGTCCTCGGGCATCGATGCCCTCAGCCACCACAGCCCCAGTGGCTCGTCCGAC
GCCAGCGGCGGCTTTGGCCTGGCCCTGGGCACCCACGCCAACGGTCTGGACTCGCCACCC
ATGTTTGCAGGCGCCGGGCTGGGAGGCACCCCATGCCGCAAGAGCTACGAGGACTGTGCC
AGCGGCATCATGGAGGACTCGGCCATCAAGTGCGAGTACATGCTCAACGCCATCCCCAAG
CGCCTGTGCCTCGTGTGCGGGGACATTGCCTCTGGCTACCACTACGGCGTGGCCTCCTGC
GAGGCTTGCAAGGCCTTCTTCAAGAGGACTATCCAAGGGAACATTGAGTACAGCTGCCCG
GCCACCAACGAGTGCGAGATCACCAAACGGAGGCGCAAGTCCTGCCAGGCCTGCCGCTTC
ATGAAATGCCTCAAAGTGGGGATGCTGAAGGAAGGTGTGCGCCTTGATCGAGTGCGTGGA
GGCCGTCAGAAATACAAGCGACGGCTGGACTCAGAGAGCAGCCCATACCTGAGCTTACAA
ATTTCTCCACCTGCTAAAAAGCCATTGACCAAGATTGTCTCATACCTACTGGTGGCTGAG
CCGGACAAGCTCTATGCCATGCCTCCCCCTGGTATGCCTGAGGGGGACATCAAGGCCCTG
ACCACTCTCTGTGACCTGGCAGACCGAGAGCTTGTGGTCATCATTGGCTGGGCCAAGCAC
ATCCCAGGCTTCTCAAGCCTCTCCCTGGGGGACCAGATGAGCCTGCTGCAGAGTGCCTGG
ATGGAAATCCTCATCCTGGGCATCGTGTACCGCTCGCTGCCCTATGACGACAAGCTGGTG
TACGCTGAGGACTACATCATGGATGAGGAGCACTCCCGCCTCGCGGGGCTGCTGGAGCTC
TACCGGGCCATCCTGCAGCTGGTACGCAGGTACAAGAAGCTCAAGGTGGAGAAGGAGGAG
TTTGTGACGCTCAAGGCCCTGGCCCTCGCCAACTCCGATTCCATGTACATCGAGGATCTA
GAGGCTGTCCAGAAGCTGCAGGACCTGCTGCACGAGGCACTGCAGGACTACGAGCTGAGC
CAGCGCCATGAGGAGCCCTGGAGGACGGGCAAGCTGCTGCTGACACTGCCGCTGCTGCGG
CAGACGGCCGCCAAGGCCGTGCAGCACTTCTATAGCGTCAAACTGCAGGGCAAAGTGCCC
ATGCACAAACTCTTCCTGGAGATGCTGGAGGCCAAGGTTGGCCAAGAGCAGCTTAGAGGA
TCTCCCAAGGATGAAAGAATGTCAAGCCATGATGGAAAATGCCCCTTCCAATCAGCTGCC
TTCACAAGCAGGGATCAGAGCAACTCCCCGGGGATCCCCAATCCACGCCCTTCTAGTCCA
ACCCCCCTCAATGAGAGAGGCAGGCAGATCTCACCCAGCACTAGGACACCAGGAGGCCAG
GGAAAGCATCTCTGGCTCACCATGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:3473
Chromosome Location14
LocusNot Available
References
  1. Chen F, Zhang Q, McDonald T, Davidoff MJ, Bailey W, Bai C, Liu Q, Caskey CT: Identification of two hERR2-related novel nuclear receptors utilizing bioinformatics and inverse PCR. Gene. 1999 Mar 4;228(1-2):101-9. 10072763
  2. Zhou W, Liu Z, Wu J, Liu JH, Hyder SM, Antoniou E, Lubahn DB: Identification and characterization of two novel splicing isoforms of human estrogen-related receptor beta. J Clin Endocrinol Metab. 2006 Feb;91(2):569-79. Epub 2005 Dec 6. 16332939
  3. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. 12508121
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Bombail V, Collins F, Brown P, Saunders PT: Modulation of ER alpha transcriptional activity by the orphan nuclear receptor ERR beta and evidence for differential effects of long- and short-form splice variants. Mol Cell Endocrinol. 2010 Jan 15;314(1):53-61. doi: 10.1016/j.mce.2009.09.007. Epub 2009 Sep 13. 19755138
  6. Cho Y, Hazen BC, Russell AP, Kralli A: Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells. J Biol Chem. 2013 Aug 30;288(35):25207-18. doi: 10.1074/jbc.M113.489674. Epub 2013 Jul 8. 23836911
  7. Gearhart MD, Holmbeck SM, Evans RM, Dyson HJ, Wright PE: Monomeric complex of human orphan estrogen related receptor-2 with DNA: a pseudo-dimer interface mediates extended half-site recognition. J Mol Biol. 2003 Apr 4;327(4):819-32. 12654265
  8. Bombail V, MacPherson S, Critchley HO, Saunders PT: Estrogen receptor related beta is expressed in human endometrium throughout the normal menstrual cycle. Hum Reprod. 2008 Dec;23(12):2782-90. doi: 10.1093/humrep/den298. Epub 2008 Sep 4. 18775884
  9. Wilson BJ, Tremblay AM, Deblois G, Sylvain-Drolet G, Giguere V: An acetylation switch modulates the transcriptional activity of estrogen-related receptor alpha. Mol Endocrinol. 2010 Jul;24(7):1349-58. doi: 10.1210/me.2009-0441. Epub 2010 May 19. 20484414
  10. Collin RW, Kalay E, Tariq M, Peters T, van der Zwaag B, Venselaar H, Oostrik J, Lee K, Ahmed ZM, Caylan R, Li Y, Spierenburg HA, Eyupoglu E, Heister A, Riazuddin S, Bahat E, Ansar M, Arslan S, Wollnik B, Brunner HG, Cremers CW, Karaguzel A, Ahmad W, Cremers FP, Vriend G, Friedman TB, Riazuddin S, Leal SM, Kremer H: Mutations of ESRRB encoding estrogen-related receptor beta cause autosomal-recessive nonsyndromic hearing impairment DFNB35. Am J Hum Genet. 2008 Jan;82(1):125-38. doi: 10.1016/j.ajhg.2007.09.008. 18179891