Ig lambda chain V-II region MGC

NameIg lambda chain V-II region MGC
SynonymsNot Available
Gene NameNot Available
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016940|Ig lambda chain V-II region MGC
QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGV
PDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLG
Number of residues111
Molecular Weight11557.51
Theoretical pI4.91
GO Classification
Functions
  • antigen binding
Processes
  • immune response
  • complement activation
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
  • Fc-epsilon receptor signaling pathway
  • receptor-mediated endocytosis
  • regulation of immune response
  • complement activation, classical pathway
Components
  • extracellular region
  • plasma membrane
General FunctionAntigen binding
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP01709
UniProtKB Entry NameLV206_HUMAN
Cellular LocationNot Available
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. 4415202
  2. Fett FW, Deutsch HF: A new lambda-chain gene. Immunochemistry. 1975 Aug;12(8):643-52. 812801
  3. Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. 2515285