You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMyoglobin
SynonymsNot Available
Gene NameMB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013125|Myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Number of residues154
Molecular Weight17183.725
Theoretical pINot Available
GO Classification
Functions
  • metal ion binding
  • oxygen transporter activity
  • heme binding
  • oxygen binding
Processes
  • response to hydrogen peroxide
  • heart development
  • response to hypoxia
  • response to hormone
  • brown fat cell differentiation
  • enucleate erythrocyte differentiation
  • slow-twitch skeletal muscle fiber contraction
Components
  • extracellular exosome
General FunctionOxygen transporter activity
Specific FunctionServes as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP02144
UniProtKB Entry NameMYG_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0013126|Myoglobin (MB)
ATGGGGCTCAGCGACGGGGAATGGCAGTTGGTGCTGAACGTCTGGGGGAAGGTGGAGGCT
GACATCCCAGGCCATGGGCAGGAAGTCCTCATCAGGCTCTTTAAGGGTCACCCAGAGACT
CTGGAGAAGTTTGACAAGTTCAAGCACCTGAAGTCAGAGGACGAGATGAAGGCGTCTGAG
GACTTAAAGAAGCATGGTGCCACCGTGCTCACCGCCCTGGGTGGCATCCTTAAGAAGAAG
GGGCATCATGAGGCAGAGATTAAGCCCCTGGCACAGTCGCATGCCACCAAGCACAAGATC
CCCGTGAAGTACCTGGAGTTCATCTCGGAATGCATCATCCAGGTTCTGCAGAGCAAGCAT
CCCGGGGACTTTGGTGCTGATGCCCAGGGGGCCATGAACAAGGCCCTGGAGCTGTTCCGG
AAGGACATGGCCTCCAACTACAAGGAGCTGGGCTTCCAGGGCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6915
Chromosome Location22
LocusNot Available
References
  1. Weller P, Jeffreys AJ, Wilson V, Blanchetot A: Organization of the human myoglobin gene. EMBO J. 1984 Feb;3(2):439-46. 6571704
  2. Akaboshi E: Cloning of the human myoglobin gene. Gene. 1985;33(3):241-9. 2989088
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. 15461802
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Herrera AE, Lehmann H: Primary structure of human myoglobin. Nat New Biol. 1971 Aug 4;232(31):149-52. 5285572
  7. Romero Herrera AE, Lehmann H: The myoglobin of primates. I. Hylobates agilis (gibbon). Biochim Biophys Acta. 1971 Dec 28;251(3):482-8. 11452891
  8. Romero Herrera AE, Lehmann H: The myoglobin of primates. II. Pan Troglodytes (chimpanzee). Biochim Biophys Acta. 1972 Aug 31;278(1):62-7. 4627044
  9. Corbett JM, Wheeler CH, Baker CS, Yacoub MH, Dunn MJ: The human myocardial two-dimensional gel protein database: update 1994. Electrophoresis. 1994 Nov;15(11):1459-65. 7895732
  10. Boulton FE, Huntsman RG, Lorkin PA, Lehmann H: Abnormal human myoglobin: 53 (D4) glutamic acid--lysine. Nature. 1969 Aug 23;223(5208):832-3. 5805522
  11. Boulton FE, Huntsman RG, Romero Herrera A, Lorkin PA, Lehmann H: The third variant of human myoglobin showing an unusual amino acid substitution: 138(H16)arginine--tryptophan. Biochim Biophys Acta. 1971 Mar 23;229(3):716-9. 5555219
  12. Boulton FE, Huntsman RG, Romero Herrera AE, Lorkin PA, Lehmann H: A human myoglobin variant 133 (H-10)lysine--asparagine. Biochim Biophys Acta. 1971 Mar 23;229(3):871-6. 5555226
  13. Boulton FE, Huntsman RG, Yawson GI, Romero Herrera AE, Lorkin PA, Lehmann H: The second variant of human myoglobin; 138(H16) arginine leads to glutamine. Br J Haematol. 1971 Jan;20(1):69-74. 5540041
  14. Hubbard SR, Hendrickson WA, Lambright DG, Boxer SG: X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution. J Mol Biol. 1990 May 20;213(2):215-8. 2342104