You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSemenogelin-1
Synonyms
  • Cancer/testis antigen 103
  • Semenogelin I
  • SEMG
  • SGI
Gene NameSEMG1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009862|Semenogelin-1
MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESK
GSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSK
GHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSG
AQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCP
AHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHY
GENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH
EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT
Number of residues462
Molecular Weight52130.885
Theoretical pINot Available
GO Classification
Functions
  • structural molecule activity
  • metal ion binding
Processes
  • negative regulation of sperm motility
  • coagulation
  • negative regulation of calcium ion import
  • positive regulation of serine-type endopeptidase activity
  • cellular protein metabolic process
  • protein heterooligomerization
  • antibacterial humoral response
  • insemination
Components
  • protein complex
  • extracellular region
  • nucleus
  • extracellular space
  • extracellular exosome
  • secretory granule
General FunctionStructural molecule activity
Specific FunctionPredominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP04279
UniProtKB Entry NameSEMG1_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0020903|Semenogelin-1 (SEMG1)
ATGAAGCCCAACATCATCTTTGTACTTTCCCTGCTCCTCATCTTGGAGAAGCAAGCAGCT
GTGATGGGACAAAAAGGTGGATCAAAAGGCCGATTACCAAGTGAATTTTCCCAATTTCCA
CACGGACAAAAGGGCCAGCACTATTCTGGACAAAAAGGCAAGCAACAAACTGAATCCAAA
GGCAGTTTTTCTATTCAATACACATATCATGTAGATGCCAATGATCATGACCAGTCCCGA
AAAAGTCAGCAATATGATTTGAATGCCCTACATAAGACGACAAAATCACAACGACATCTA
GGTGGAAGTCAACAACTGCTCCATAATAAACAAGAAGGCAGAGACCATGATAAATCAAAA
GGTCATTTTCACAGGGTAGTTATACACCATAAAGGAGGCAAAGCTCATCGTGGGACACAA
AATCCTTCTCAAGATCAGGGGAATAGCCCATCTGGAAAGGGAATATCCAGTCAATATTCA
AACACAGAAGAAAGGCTGTGGGTTCATGGACTAAGTAAAGAACAAACTTCCGTCTCTGGT
GCACAAAAAGGTAGAAAACAAGGCGGATCCCAAAGCAGTTATGTTCTCCAAACTGAAGAG
CTAGTAGCTAACAAACAACAACGTGAGACTAAAAATTCTCATCAAAATAAAGGGCATTAC
CAAAATGTGGTTGAAGTGAGAGAGGAACATTCAAGTAAAGTACAAACCTCACTCTGTCCT
GCGCACCAAGACAAACTCCAACATGGATCCAAAGACATTTTTTCTACCCAAGATGAGCTC
CTAGTATATAACAAGAATCAACACCAGACAAAAAATCTCAATCAAGATCAACAGCATGGC
CGAAAGGCAAATAAAATATCATACCAATCTTCAAGTACAGAAGAAAGACGACTCCACTAT
GGAGAAAATGGTGTGCAGAAAGATGTATCCCAAAGCAGTATTTATAGCCAAACTGAAGAG
AAAGCACAGGGCAAGTCTCAAAAACAGATAACAATTCCCAGTCAAGAGCAAGAGCATAGC
CAAAAGGCAAATAAAATATCATACCAATCTTCAAGTACGGAAGAAAGACGACTCCACTAT
GGAGAAAATGGTGTGCAGAAAGATGTATCCCAACGCAGTATTTATAGCCAAACTGAAAAG
CTAGTAGCAGGCAAGTCTCAAATCCAGGCACCAAATCCTAAGCAAGAGCCATGGCATGGT
GAAAATGCAAAAGGAGAGTCTGGCCAATCTACAAATAGAGAACAAGACCTACTCAGTCAT
GAACAAAAAGGCAGACACCAACATGGATCTCATGGGGGATTGGATATTGTAATTATAGAG
CAGGAAGATGACAGTGATCGTCATTTGGCACAACATCTTAACAACGACCGAAACCCATTA
TTTACATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10742
Chromosome Location20
LocusNot Available
References
  1. Lilja H, Abrahamsson PA, Lundwall A: Semenogelin, the predominant protein in human semen. Primary structure and identification of closely related proteins in the male accessory sex glands and on the spermatozoa. J Biol Chem. 1989 Jan 25;264(3):1894-900. 2912989
  2. Ulvsback M, Lazure C, Lilja H, Spurr NK, Rao VV, Loffler C, Hansmann I, Lundwall A: Gene structure of semenogelin I and II. The predominant proteins in human semen are encoded by two homologous genes on chromosome 20. J Biol Chem. 1992 Sep 5;267(25):18080-4. 1517240
  3. Jensen-Seaman MI, Li WH: Evolution of the hominoid semenogelin genes, the major proteins of ejaculated semen. J Mol Evol. 2003 Sep;57(3):261-70. 14629036
  4. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Kingan SB, Tatar M, Rand DM: Reduced polymorphism in the chimpanzee semen coagulating protein, semenogelin I. J Mol Evol. 2003 Aug;57(2):159-69. 14562960
  7. Lilja H, Jeppsson JO: Amino acid sequence of the predominant basic protein in human seminal plasma. FEBS Lett. 1985 Mar 11;182(1):181-4. 3972122
  8. Seidah NG, Ramasharma K, Sairam MR, Chretien M: Partial amino acid sequence of a human seminal plasma peptide with inhibin-like activity. FEBS Lett. 1984 Feb 13;167(1):98-102. 6698208
  9. Ramasharma K, Sairam MR, Seidah NG, Chretien M, Manjunath P, Schiller PW, Yamashiro D, Li CH: Isolation, structure, and synthesis of a human seminal plasma peptide with inhibin-like activity. Science. 1984 Mar 16;223(4641):1199-202. 6422553
  10. Schneider K, Kausler W, Tripier D, Jouvenal K, Spiteller G: [Isolation and structure determination of two peptides occurring in human seminal plasma]. Biol Chem Hoppe Seyler. 1989 Apr;370(4):353-6. 2757795
  11. Khan Z, Smyth DG: Isolation and identification of N-terminally extended forms of 5-oxoprolylglutamylprolinamide (Glp-Glu-Pro-NH2), a thyrotropin-releasing-hormone (TRH)-like peptide present in human semen. Eur J Biochem. 1993 Feb 15;212(1):35-40. 8444163
  12. Li CH, Hammonds RG Jr, Ramasharma K, Chung D: Human seminal alpha inhibins: isolation, characterization, and structure. Proc Natl Acad Sci U S A. 1985 Jun;82(12):4041-4. 3889920
  13. Robert M, Gagnon C: Semenogelin I: a coagulum forming, multifunctional seminal vesicle protein. Cell Mol Life Sci. 1999 Jun;55(6-7):944-60. 10412373
  14. Wang Z, Widgren EE, Sivashanmugam P, O'Rand MG, Richardson RT: Association of eppin with semenogelin on human spermatozoa. Biol Reprod. 2005 May;72(5):1064-70. Epub 2004 Dec 8. 15590901
  15. Wang Z, Widgren EE, Richardson RT, O'Rand MG: Characterization of an eppin protein complex from human semen and spermatozoa. Biol Reprod. 2007 Sep;77(3):476-84. Epub 2007 Jun 13. 17567961
  16. Mitra A, Richardson RT, O'Rand MG: Analysis of recombinant human semenogelin as an inhibitor of human sperm motility. Biol Reprod. 2010 Mar;82(3):489-96. doi: 10.1095/biolreprod.109.081331. Epub 2009 Nov 4. 19889947