U1 small nuclear ribonucleoprotein A

NameU1 small nuclear ribonucleoprotein A
Synonyms
  • U1 snRNP A
Gene NameSNRPA
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019322|U1 small nuclear ribonucleoprotein A
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA
TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI
PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Number of residues282
Molecular Weight31279.365
Theoretical pI10.5
GO Classification
Functions
  • snRNA stem-loop binding
  • U1 snRNA binding
  • nucleotide binding
  • RNA binding
  • poly(A) RNA binding
Processes
  • RNA splicing
  • gene expression
  • mRNA splicing, via spliceosome
Components
  • spliceosomal complex
  • U1 snRNP
  • cytoplasm
  • nucleolus
  • nucleoplasm
General FunctionU1 snrna binding
Specific FunctionComponent of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1 snRNP is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. May bind preferentially to the 5'-UGCAC-3' motif on RNAs.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP09012
UniProtKB Entry NameSNRPA_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0019323|U1 small nuclear ribonucleoprotein A (SNRPA)
ATGGCAGTTCCCGAGACCCGCCCTAACCACACTATTTATATCAACAACCTCAATGAGAAG
ATCAAGAAGGATGAGCTAAAAAAGTCCCTGTACGCCATCTTCTCCCAGTTTGGCCAGATC
CTGGATATCCTGGTATCACGGAGCCTGAAGATGAGGGGCCAGGCCTTTGTCATCTTCAAG
GAGGTCAGCAGCGCCACCAACGCCCTGCGCTCCATGCAGGGTTTCCCTTTCTATGACAAA
CCTATGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACC
TTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCC
ACCAAGAAGGCTGTGCAAGGCGGGGGAGCCACCCCCGTGGTGGGGGCTGTCCAGGGGCCT
GTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAG
CCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATC
CCACCAGGGGCCATGCCCCCGCAGCAGCTTATGCCAGGACAGATGCCCCCTGCCCAGCCT
CTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAAC
GAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTA
CCCGGGCGGCATGACATCGCCTTCGTGGAGTTTGACAATGAGGTACAGGCAGGGGCAGCT
CGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCC
AAGAAGTAG
GenBank Gene IDM60784
GeneCard IDNot Available
GenAtlas IDSNRPA
HGNC IDHGNC:11151
Chromosome Location19
Locus19q13.1
References
  1. Nelissen RL, Sillekens PT, Beijer RP, Geurts van Kessel AH, van Venrooij WJ: Structure, chromosomal localization and evolutionary conservation of the gene encoding human U1 snRNP-specific A protein. Gene. 1991 Jun 30;102(2):189-96. 1831431
  2. Sillekens PT, Habets WJ, Beijer RP, van Venrooij WJ: cDNA cloning of the human U1 snRNA-associated A protein: extensive homology between U1 and U2 snRNP-specific proteins. EMBO J. 1987 Dec 1;6(12):3841-8. 2962859
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Lutz CS, Cooke C, O'Connor JP, Kobayashi R, Alwine JC: The snRNP-free U1A (SF-A) complex(es): identification of the largest subunit as PSF, the polypyrimidine-tract binding protein-associated splicing factor. RNA. 1998 Dec;4(12):1493-9. 9848648
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  7. Ray D, Kazan H, Chan ET, Pena Castillo L, Chaudhry S, Talukder S, Blencowe BJ, Morris Q, Hughes TR: Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins. Nat Biotechnol. 2009 Jul;27(7):667-70. doi: 10.1038/nbt.1550. Epub 2009 Jun 28. 19561594
  8. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  9. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  11. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  12. Nagai K, Oubridge C, Jessen TH, Li J, Evans PR: Crystal structure of the RNA-binding domain of the U1 small nuclear ribonucleoprotein A. Nature. 1990 Dec 6;348(6301):515-20. 2147232
  13. Oubridge C, Ito N, Evans PR, Teo CH, Nagai K: Crystal structure at 1.92 A resolution of the RNA-binding domain of the U1A spliceosomal protein complexed with an RNA hairpin. Nature. 1994 Dec 1;372(6505):432-8. 7984237
  14. Hoffman DW, Query CC, Golden BL, White SW, Keene JD: RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins. Proc Natl Acad Sci U S A. 1991 Mar 15;88(6):2495-9. 1826055
  15. Howe PW, Nagai K, Neuhaus D, Varani G: NMR studies of U1 snRNA recognition by the N-terminal RNP domain of the human U1A protein. EMBO J. 1994 Aug 15;13(16):3873-81. 8070414
  16. Allain FH, Gubser CC, Howe PW, Nagai K, Neuhaus D, Varani G: Specificity of ribonucleoprotein interaction determined by RNA folding during complex formulation. Nature. 1996 Apr 18;380(6575):646-50. 8602269
  17. Avis JM, Allain FH, Howe PW, Varani G, Nagai K, Neuhaus D: Solution structure of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability and RNA binding. J Mol Biol. 1996 Mar 29;257(2):398-411. 8609632
  18. Allain FH, Howe PW, Neuhaus D, Varani G: Structural basis of the RNA-binding specificity of human U1A protein. EMBO J. 1997 Sep 15;16(18):5764-72. 9312034
  19. Lu J, Hall KB: Tertiary structure of RBD2 and backbone dynamics of RBD1 and RBD2 of the human U1A protein determined by NMR spectroscopy. Biochemistry. 1997 Aug 26;36(34):10393-405. 9265619
  20. Jessen TH, Oubridge C, Teo CH, Pritchard C, Nagai K: Identification of molecular contacts between the U1 A small nuclear ribonucleoprotein and U1 RNA. EMBO J. 1991 Nov;10(11):3447-56. 1833186