| Name | Fatty acid metabolism regulator protein |
|---|
| Synonyms | |
|---|
| Gene Name | fadR |
|---|
| Organism | Escherichia coli (strain K12) |
|---|
| Amino acid sequence | >lcl|BSEQ0012953|Fatty acid metabolism regulator protein
MVIKAQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGW
LTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQH
PDKAQEVLATANEVADHADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYF
ANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDLAIQGR |
|---|
| Number of residues | 239 |
|---|
| Molecular Weight | 26968.35 |
|---|
| Theoretical pI | 7.03 |
|---|
| GO Classification | Functions - fatty-acyl-CoA binding
- transcription factor activity, sequence-specific DNA binding
- DNA binding
Processes - positive regulation of transcription, DNA-templated
- transcription, DNA-templated
- negative regulation of transcription, DNA-templated
- regulation of fatty acid metabolic process
- positive regulation of fatty acid biosynthetic process
- fatty acid oxidation
Components |
|---|
| General Function | Multifunctional regulator of fatty acid metabolism (PubMed:1569108, PubMed:8446033, PubMed:9388199, PubMed:11859088, PubMed:19854834, PubMed:21276098). Represses transcription of at least eight genes required for fatty acid transport and beta-oxidation including fadA, fadB, fadD, fadL and fadE (PubMed:9388199). Activates transcription of at least three genes required for unsaturated fatty acid biosynthesis: fabA, fabB and iclR, the gene encoding the transcriptional regulator of the aceBAK operon encoding the glyoxylate shunt enzymes (PubMed:9388199). |
|---|
| Specific Function | Dna binding |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | 992991 |
|---|
| UniProtKB ID | P0A8V6 |
|---|
| UniProtKB Entry Name | FADR_ECOLI |
|---|
| Cellular Location | Cytoplasm |
|---|
| Gene sequence | >lcl|BSEQ0012954|Fatty acid metabolism regulator protein (fadR)
ATGGTCATTAAGGCGCAAAGCCCGGCGGGTTTCGCGGAAGAGTACATTATTGAAAGTATC
TGGAATAACCGCTTCCCTCCCGGGACTATTTTGCCCGCAGAACGTGAACTTTCAGAATTA
ATTGGCGTAACGCGTACTACGTTACGTGAAGTGTTACAGCGTCTGGCACGAGATGGCTGG
TTGACCATTCAACATGGCAAGCCGACGAAGGTGAATAATTTCTGGGAAACTTCCGGTTTA
AATATCCTTGAAACACTGGCGCGACTGGATCACGAAAGTGTGCCGCAGCTTATTGATAAT
TTGCTGTCGGTGCGTACCAATATTTCCACTATTTTTATTCGCACCGCGTTTCGTCAGCAT
CCCGATAAAGCGCAGGAAGTGCTGGCTACCGCTAATGAAGTGGCCGATCACGCCGATGCC
TTTGCCGAGCTGGATTACAACATATTCCGCGGCCTGGCGTTTGCTTCCGGCAACCCGATT
TACGGTCTGATTCTTAACGGGATGAAAGGGCTGTATACGCGTATTGGTCGTCACTATTTC
GCCAATCCGGAAGCGCGCAGTCTGGCGCTGGGCTTCTACCACAAACTGTCGGCGTTGTGC
AGTGAAGGCGCGCACGATCAGGTGTACGAAACAGTGCGTCGCTATGGGCATGAGAGTGGC
GAGATTTGGCACCGGATGCAGAAAAATCTGCCGGGTGATTTAGCCATTCAGGGGCGATAA
|
|---|
| GenBank Gene ID | X08087 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - DiRusso CC: Nucleotide sequence of the fadR gene, a multifunctional regulator of fatty acid metabolism in Escherichia coli. Nucleic Acids Res. 1988 Aug 25;16(16):7995-8009. 2843809
- Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. 8905232
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. 9278503
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. 16738553
- DiRusso CC, Heimert TL, Metzger AK: Characterization of FadR, a global transcriptional regulator of fatty acid metabolism in Escherichia coli. Interaction with the fadB promoter is prevented by long chain fatty acyl coenzyme A. J Biol Chem. 1992 Apr 25;267(12):8685-91. 1569108
- DiRusso CC, Metzger AK, Heimert TL: Regulation of transcription of genes required for fatty acid transport and unsaturated fatty acid biosynthesis in Escherichia coli by FadR. Mol Microbiol. 1993 Jan;7(2):311-22. 8446033
- Raman N, DiRusso CC: Analysis of acyl coenzyme A binding to the transcription factor FadR and identification of amino acid residues in the carboxyl terminus required for ligand binding. J Biol Chem. 1995 Jan 20;270(3):1092-7. 7836365
- Raman N, Black PN, DiRusso CC: Characterization of the fatty acid-responsive transcription factor FadR. Biochemical and genetic analyses of the native conformation and functional domains. J Biol Chem. 1997 Dec 5;272(49):30645-50. 9388199
- Zhang YM, Marrakchi H, Rock CO: The FabR (YijC) transcription factor regulates unsaturated fatty acid biosynthesis in Escherichia coli. J Biol Chem. 2002 May 3;277(18):15558-65. Epub 2002 Feb 21. 11859088
- Zhu K, Zhang YM, Rock CO: Transcriptional regulation of membrane lipid homeostasis in Escherichia coli. J Biol Chem. 2009 Dec 11;284(50):34880-8. doi: 10.1074/jbc.M109.068239. Epub 2009 Oct 23. 19854834
- Feng Y, Cronan JE: Complex binding of the FabR repressor of bacterial unsaturated fatty acid biosynthesis to its cognate promoters. Mol Microbiol. 2011 Apr;80(1):195-218. doi: 10.1111/j.1365-2958.2011.07564.x. Epub 2011 Feb 21. 21276098
- van Aalten DM, DiRusso CC, Knudsen J, Wierenga RK: Crystal structure of FadR, a fatty acid-responsive transcription factor with a novel acyl coenzyme A-binding fold. EMBO J. 2000 Oct 2;19(19):5167-77. 11013219
- van Aalten DM, DiRusso CC, Knudsen J: The structural basis of acyl coenzyme A-dependent regulation of the transcription factor FadR. EMBO J. 2001 Apr 17;20(8):2041-50. 11296236
- Xu Y, Heath RJ, Li Z, Rock CO, White SW: The FadR.DNA complex. Transcriptional control of fatty acid metabolism in Escherichia coli. J Biol Chem. 2001 May 18;276(20):17373-9. Epub 2001 Feb 13. 11279025
|
|---|