Xanthine phosphoribosyltransferase

NameXanthine phosphoribosyltransferase
Synonyms
  • 2.4.2.22
  • gpp
  • gxu
  • Xanthine-guanine phosphoribosyltransferase
  • XGPRT
Gene Namegpt
OrganismEscherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0011448|Xanthine phosphoribosyltransferase
MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI
SSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRP
LVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
Number of residues152
Molecular Weight16970.455
Theoretical pI5.63
GO Classification
Functions
  • xanthine phosphoribosyltransferase activity
  • hypoxanthine phosphoribosyltransferase activity
  • magnesium ion binding
Processes
  • IMP salvage
  • XMP salvage
  • GMP salvage
Components
  • plasma membrane
  • cytosol
General FunctionXanthine phosphoribosyltransferase activity
Specific FunctionActs on guanine, xanthine and to a lesser extent hypoxanthine.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID41607
UniProtKB IDP0A9M5
UniProtKB Entry NameXGPT_ECOLI
Cellular LocationCell inner membrane
Gene sequence
>lcl|BSEQ0011449|Xanthine phosphoribosyltransferase (gpt)
ATGAGCGAAAAATACATCGTCACCTGGGACATGTTGCAGATCCATGCACGTAAACTCGCA
AGCCGACTGATGCCTTCTGAACAATGGAAAGGCATTATTGCCGTAAGCCGTGGCGGTCTG
GTACCGGGTGCGTTACTGGCGCGTGAACTGGGTATTCGTCATGTCGATACCGTTTGTATT
TCCAGCTACGATCACGACAACCAGCGCGAGCTTAAAGTGCTGAAACGCGCAGAAGGCGAT
GGCGAAGGCTTCATCGTTATTGATGACCTGGTGGATACCGGTGGTACTGCGGTTGCGATT
CGTGAAATGTATCCAAAAGCGCACTTTGTCACCATCTTCGCAAAACCGGCTGGTCGTCCG
CTGGTTGATGACTATGTTGTTGATATCCCGCAAGATACCTGGATTGAACAGCCGTGGGAT
ATGGGCGTCGTATTCGTCCCGCCAATCTCCGGTCGCTAA
GenBank Gene IDX00221
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Pratt D, Subramani S: Nucleotide sequence of the Escherichia coli xanthine-guanine phosphoribosyl transferase gene. Nucleic Acids Res. 1983 Dec 20;11(24):8817-23. 6324103
  2. Richardson KK, Fostel J, Skopek TR: Nucleotide sequence of the xanthine guanine phosphoribosyl transferase gene of E. coli. Nucleic Acids Res. 1983 Dec 20;11(24):8809-16. 6324102
  3. Nuesch J, Schumperli D: Structural and functional organization of the gpt gene region of Escherichia coli. Gene. 1984 Dec;32(1-2):243-9. 6397401
  4. Jagadeeswaran P, Ashman CR, Roberts S, Langenberg J: Nucleotide sequence and analysis of deletion mutants of the Escherichia coli gpt gene in plasmid pSV2 gpt. Gene. 1984 Nov;31(1-3):309-13. 6396164
  5. Richardson KK, Richardson FC, Crosby RM, Swenberg JA, Skopek TR: DNA base changes and alkylation following in vivo exposure of Escherichia coli to N-methyl-N-nitrosourea or N-ethyl-N-nitrosourea. Proc Natl Acad Sci U S A. 1987 Jan;84(2):344-8. 3540961
  6. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. 9278503
  7. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. 16738553
  8. Mulligan RC, Berg P: Factors governing the expression of a bacterial gene in mammalian cells. Mol Cell Biol. 1981 May;1(5):449-59. 6100966
  9. Vos S, de Jersey J, Martin JL: Crystal structure of Escherichia coli xanthine phosphoribosyltransferase. Biochemistry. 1997 Apr 8;36(14):4125-34. 9100006
  10. Deo SS, Tseng WC, Saini R, Coles RS, Athwal RS: Purification and characterization of Escherichia coli xanthine-guanine phosphoribosyltransferase produced by plasmid pSV2gpt. Biochim Biophys Acta. 1985 May 8;839(3):233-9. 3886014
  11. Vos S, de Jersey J, Martin JL: Crystallization and preliminary X-ray crystallographic studies of Escherichia coli xanthine phosphoribosyltransferase. J Struct Biol. 1996 Mar-Apr;116(2):330-4. 8812991
  12. Vos S, Parry RJ, Burns MR, de Jersey J, Martin JL: Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase. J Mol Biol. 1998 Oct 2;282(4):875-89. 9743633