NameHydrogen peroxide-inducible genes activator
Synonyms
  • momR
  • mor
  • Morphology and auto-aggregation control protein
Gene NameoxyR
OrganismEscherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0019229|Hydrogen peroxide-inducible genes activator
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQA
GMLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKL
EMYLHEAQTHQLLAQLDSGKLDCVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREC
VPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLL
PALAVPPERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFDKV
LKQAV
Number of residues305
Molecular Weight34275.59
Theoretical pI6.37
GO Classification
Functions
  • bacterial-type RNA polymerase core promoter proximal region sequence-specific DNA binding
  • transcription factor activity, bacterial-type RNA polymerase core promoter proximal region sequence-specific binding
Processes
  • response to oxidative stress
  • cellular response to DNA damage stimulus
  • transcription, DNA-templated
  • response to nitrosative stress
  • regulation of DNA-templated transcription, initiation
Components
  • cytosol
General FunctionTranscription factor activity, bacterial-type rna polymerase core promoter proximal region sequence-specific binding
Specific FunctionHydrogen peroxide sensor. Activates the expression of a regulon of hydrogen peroxide-inducible genes such as katG, gor, ahpC, ahpF, oxyS (a regulatory RNA), dps, fur and grxA. OxyR expression is negatively autoregulated by binding to a 43 bp region upstream of its own coding sequence. OxyR is inactivated by reduction of its essential disulfide bond by the product of GrxA, itself positively regulated by OxyR. Has also a positive regulatory effect on the production of surface proteins that control the colony morphology and auto-aggregation ability.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID147042
UniProtKB IDP0ACQ4
UniProtKB Entry NameOXYR_ECOLI
Cellular LocationCytoplasmic
Gene sequence
>lcl|BSEQ0019230|Hydrogen peroxide-inducible genes activator (oxyR)
ATGAATATTCGTGATCTTGAGTACCTGGTGGCATTGGCTGAACACCGCCATTTTCGGCGT
GCGGCAGATTCCTGCCACGTTAGCCAGCCGACGCTTAGCGGGCAAATTCGTAAGCTGGAA
GATGAGCTGGGCGTGATGTTGCTGGAGCGGACCAGCCGTAAAGTGTTGTTCACCCAGGCG
GGAATGCTGCTGGTGGATCAGGCGCGTACCGTGCTGCGTGAGGTGAAAGTCCTTAAAGAG
ATGGCAAGCCAGCAGGGCGAGACGATGTCCGGACCGCTGCACATTGGTTTGATTCCCACA
GTTGGACCGTACCTGCTACCGCATATTATCCCTATGCTGCACCAGACCTTTCCAAAGCTG
GAAATGTATCTGCATGAAGCACAGACCCACCAGTTACTGGCGCAACTGGACAGCGGCAAA
CTCGATTGCGTGATCCTCGCGCTGGTGAAAGAGAGCGAAGCATTCATTGAAGTGCCGTTG
TTTGATGAGCCAATGTTGCTGGCTATCTATGAAGATCACCCGTGGGCGAACCGCGAATGC
GTACCGATGGCCGATCTGGCAGGGGAAAAACTGCTGATGCTGGAAGATGGTCACTGTTTG
CGCGATCAGGCAATGGGTTTCTGTTTTGAAGCCGGGGCGGATGAAGATACACACTTCCGC
GCGACCAGCCTGGAAACTCTGCGCAACATGGTGGCGGCAGGTAGCGGGATCACTTTACTG
CCAGCGCTGGCTGTGCCGCCGGAGCGCAAACGCGATGGGGTTGTTTATCTGCCGTGCATT
AAGCCGGAACCACGCCGCACTATTGGCCTGGTTTATCGTCCTGGCTCACCGCTGCGCAGC
CGCTATGAGCAGCTGGCAGAGGCCATCCGCGCAAGAATGGATGGCCATTTCGATAAAGTT
TTAAAACAGGCGGTTTAA
GenBank Gene IDJ04553
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Christman MF, Storz G, Ames BN: OxyR, a positive regulator of hydrogen peroxide-inducible genes in Escherichia coli and Salmonella typhimurium, is homologous to a family of bacterial regulatory proteins. Proc Natl Acad Sci U S A. 1989 May;86(10):3484-8. 2471187
  2. Bolker M, Kahmann R: The Escherichia coli regulatory protein OxyR discriminates between methylated and unmethylated states of the phage Mu mom promoter. EMBO J. 1989 Aug;8(8):2403-10. 2551682
  3. Tao K, Makino K, Yonei S, Nakata A, Shinagawa H: Molecular cloning and nucleotide sequencing of oxyR, the positive regulatory gene of a regulon for an adaptive response to oxidative stress in Escherichia coli: homologies between OxyR protein and a family of bacterial activator proteins. Mol Gen Genet. 1989 Sep;218(3):371-6. 2511419
  4. Warne SR, Varley JM, Boulnois GJ, Norton MG: Identification and characterization of a gene that controls colony morphology and auto-aggregation in Escherichia coli K12. J Gen Microbiol. 1990 Mar;136(3):455-62. 2167922
  5. Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL: Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Nucleic Acids Res. 1993 Nov 25;21(23):5408-17. 8265357
  6. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. 9278503
  7. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. 16738553
  8. Tao K, Makino K, Yonei S, Nakata A, Shinagawa H: Purification and characterization of the Escherichia coli OxyR protein, the positive regulator for a hydrogen peroxide-inducible regulon. J Biochem. 1991 Feb;109(2):262-6. 1864839
  9. Zheng M, Aslund F, Storz G: Activation of the OxyR transcription factor by reversible disulfide bond formation. Science. 1998 Mar 13;279(5357):1718-21. 9497290
  10. Kim SO, Merchant K, Nudelman R, Beyer WF Jr, Keng T, DeAngelo J, Hausladen A, Stamler JS: OxyR: a molecular code for redox-related signaling. Cell. 2002 May 3;109(3):383-96. 12015987