| Name | Glycerol uptake facilitator protein |
|---|
| Synonyms | |
|---|
| Gene Name | glpF |
|---|
| Organism | Escherichia coli (strain K12) |
|---|
| Amino acid sequence | >lcl|BSEQ0016653|Glycerol uptake facilitator protein
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH
IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL |
|---|
| Number of residues | 281 |
|---|
| Molecular Weight | 29779.71 |
|---|
| Theoretical pI | 6.66 |
|---|
| GO Classification | Functions - glycerol transmembrane transporter activity
- metal ion binding
- glycerol channel activity
- water channel activity
Processes - cellular water homeostasis
- glycerol transport
- cellular response to mercury ion
- ion transmembrane transport
- water transport
Components - plasma membrane
- integral component of plasma membrane
|
|---|
| General Function | Water channel activity |
|---|
| Specific Function | Transporter of glycerol across the cytoplasmic membrane, with limited permeability to water and small uncharged compounds such as polyols. |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | 6-34
40-60
85-108
144-169
178-194
232-254 |
|---|
| GenBank Protein ID | Not Available |
|---|
| UniProtKB ID | P0AER0 |
|---|
| UniProtKB Entry Name | GLPF_ECOLI |
|---|
| Cellular Location | Cell inner membrane |
|---|
| Gene sequence | >lcl|BSEQ0016654|Glycerol uptake facilitator protein (glpF)
ATGAGTCAAACATCAACCTTGAAAGGCCAGTGCATTGCTGAATTCCTCGGTACCGGGTTG
TTGATTTTCTTCGGTGTGGGTTGCGTTGCAGCACTAAAAGTCGCTGGTGCGTCTTTTGGT
CAGTGGGAAATCAGTGTCATTTGGGGACTGGGGGTGGCAATGGCCATCTACCTGACCGCA
GGGGTTTCCGGCGCGCATCTTAATCCCGCTGTTACCATTGCATTGTGGCTGTTTGCCTGT
TTCGACAAGCGCAAAGTTATTCCTTTTATCGTTTCACAAGTTGCCGGCGCTTTCTGTGCT
GCGGCTTTAGTTTACGGGCTTTACTACAATTTATTTTTCGACTTCGAGCAGACTCATCAC
ATTGTTCGCGGCAGCGTTGAAAGTGTTGATCTGGCTGGCACTTTCTCTACTTACCCTAAT
CCTCATATCAATTTTGTGCAGGCTTTCGCAGTTGAGATGGTGATTACCGCTATTCTGATG
GGGCTGATCCTGGCGTTAACGGACGATGGCAACGGTGTACCACGCGGCCCTTTGGCTCCC
TTGCTGATTGGTCTACTGATTGCGGTCATTGGCGCATCTATGGGCCCATTGACAGGTTTT
GCCATGAACCCAGCGCGTGACTTCGGTCCGAAAGTCTTTGCCTGGCTGGCGGGCTGGGGC
AATGTCGCCTTTACCGGCGGCAGAGACATTCCTTACTTCCTGGTGCCGCTTTTCGGCCCT
ATCGTTGGCGCGATTGTAGGTGCATTTGCCTACCGCAAACTGATTGGTCGCCATTTGCCT
TGCGATATCTGTGTTGTGGAAGAAAAGGAAACCACAACTCCTTCAGAACAAAAAGCTTCG
CTGTAA |
|---|
| GenBank Gene ID | X15054 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Muramatsu S, Mizuno T: Nucleotide sequence of the region encompassing the glpKF operon and its upstream region containing a bent DNA sequence of Escherichia coli. Nucleic Acids Res. 1989 Jun 12;17(11):4378. 2544860
- Weissenborn DL, Wittekindt N, Larson TJ: Structure and regulation of the glpFK operon encoding glycerol diffusion facilitator and glycerol kinase of Escherichia coli K-12. J Biol Chem. 1992 Mar 25;267(9):6122-31. 1372899
- Plunkett G 3rd, Burland V, Daniels DL, Blattner FR: Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes. Nucleic Acids Res. 1993 Jul 25;21(15):3391-8. 8346018
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. 9278503
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. 16738553
- Heller KB, Lin EC, Wilson TH: Substrate specificity and transport properties of the glycerol facilitator of Escherichia coli. J Bacteriol. 1980 Oct;144(1):274-8. 6998951
- Borgnia MJ, Agre P: Reconstitution and functional comparison of purified GlpF and AqpZ, the glycerol and water channels from Escherichia coli. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2888-93. Epub 2001 Feb 20. 11226336
- Daley DO, Rapp M, Granseth E, Melen K, Drew D, von Heijne G: Global topology analysis of the Escherichia coli inner membrane proteome. Science. 2005 May 27;308(5726):1321-3. 15919996
- Fu D, Libson A, Miercke LJ, Weitzman C, Nollert P, Krucinski J, Stroud RM: Structure of a glycerol-conducting channel and the basis for its selectivity. Science. 2000 Oct 20;290(5491):481-6. 11039922
- Unger VM: Fraternal twins: AQP1 and GlpF. Nat Struct Biol. 2000 Dec;7(12):1082-4. 11101882
- Tajkhorshid E, Nollert P, Jensen MO, Miercke LJ, O'Connell J, Stroud RM, Schulten K: Control of the selectivity of the aquaporin water channel family by global orientational tuning. Science. 2002 Apr 19;296(5567):525-30. 11964478
|
|---|