Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeurofilament heavy polypeptide
Synonyms
  • 200 kDa neurofilament protein
  • KIAA0845
  • Neurofilament triplet H protein
  • NF-H
  • NFH
Gene NameNEFH
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009025|Neurofilament heavy polypeptide
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSA
SPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKVRQLEA
HNRSLEGEAAALRQQQAGRSAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAH
VRQRLDDEARQREEAEAAARALARFAQEAEAARVDLQKKAQALQEECGYLRRHHQEEVGE
LLGQIQGSGAAQAQMQAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRL
SEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASY
QEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPIPF
SLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKE
EEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKS
PAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKS
PEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEKAKSPEKAKS
PEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKE
EAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAKTPAKEEA
RSPADKFPEKAKSPVKEEVKSPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVK
VKEPPKKAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEKKEPAVEKPKESKVEAKK
EEAEDKKKVPTPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEK
KDTKEEKAKKPEEKPKTEAKAKEDDKTLSKEPSKPKAEKAEKSSSTDQKDSKPPEKATED
KAAKGK
Number of residues1026
Molecular Weight112477.915
Theoretical pINot Available
GO Classification
Functions
  • structural molecule activity
  • kinesin binding
  • structural constituent of cytoskeleton
  • dynein binding
  • protein binding, bridging
  • toxic substance binding
  • protein kinase binding
  • microtubule binding
Processes
  • response to sodium arsenite
  • spinal cord development
  • cell projection assembly
  • hippocampus development
  • axon regeneration
  • axon development
  • cellular response to oxidative stress
  • cellular response to estradiol stimulus
  • neurofilament bundle assembly
  • ovarian follicle atresia
  • axonogenesis
  • cerebral cortex development
  • peripheral nervous system neuron axonogenesis
  • microtubule cytoskeleton organization
  • regulation of organelle transport along microtubule
  • response to cocaine
  • response to acrylamide
Components
  • neurofibrillary tangle
  • mitochondrion
  • nucleus
  • axon
  • neurofilament
  • myelin sheath
  • perikaryon
  • cytoplasm
  • neuronal postsynaptic density
General FunctionToxic substance binding
Specific FunctionNeurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. NF-H has an important function in mature axons that is not subserved by the two smaller NF proteins.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP12036
UniProtKB Entry NameNFH_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0013570|Neurofilament heavy polypeptide (NEFH)
ATGATGAGCTTCGGCGGCGCGGACGCGCTGCTGGGCGCCCCGTTCGCGCCGCTGCATGGC
GGCGGCAGCCTCCACTACGCGCTAGCCCGAAAGGGTGGCGCAGGCGGGACGCGCTCCGCC
GCTGGCTCCTCCAGCGGCTTCCACTCGTGGACACGGACGTCCGTGAGCTCCGTGTCCGCC
TCGCCCAGCCGCTTCCGTGGCGCAGGCGCCGCCTCAAGCACCGACTCGCTGGACACGCTG
AGCAACGGGCCGGAGGGCTGCATGGTGGCGGTGGCCACCTCACGCAGTGAGAAGGAGCAG
CTGCAGGCGCTGAACGACCGCTTCGCCGGGTACATCGACAAGGTGCGGCAGCTGGAGGCG
CACAACCGCAGCCTGGAGGGCGAGGCTGCGGCGCTGCGGCAGCAGCAGGCGGGCCGCTCC
GCTATGGGCGAGCTGTACGAGCGCGAGGTCCGCGAGATGCGCGGCGCGGTGCTGCGCCTG
GGCGCGGCGCGCGGTCAGCTACGCCTGGAGCAGGAGCACCTGCTCGAGGACATCGCGCAC
GTGCGCCAGCGCCTAGACGACGAGGCCCGGCAGCGAGAGGAGGCCGAGGCGGCGGCCCGC
GCGCTGGCGCGCTTCGCGCAGGAGGCCGAGGCGGCGCGCGTGGACCTGCAGAAGAAGGCG
CAGGCGCTGCAGGAGGAGTGCGGCTACCTGCGGCGCCACCACCAGGAAGAGGTGGGCGAG
CTGCTCGGCCAGATCCAGGGCTCCGGCGCCGCGCAGGCGCAGATGCAGGCCGAGACGCGC
GACGCCCTGAAGTGCGACGTGACGTCGGCGCTGCGCGAGATTCGCGCGCAGCTTGAAGGC
CACGCGGTGCAGAGCACGCTGCAGTCCGAGGAGTGGTTCCGAGTGAGGCTGGACCGACTG
TCGGAGGCAGCCAAGGTGAACACAGACGCTATGCGCTCAGCGCAGGAGGAGATAACTGAG
TACCGGCGTCAGCTGCAGGCCAGGACCACAGAGCTGGAGGCACTGAAAAGCACCAAGGAC
TCACTGGAGAGGCAGCGCTCTGAGCTGGAGGACCGTCATCAGGCCGACATTGCCTCCTAC
CAGGAAGCCATTCAGCAGCTGGACGCTGAGCTGAGGAACACCAAGTGGGAGATGGCCGCC
CAGCTGCGAGAATACCAGGACCTGCTCAATGTCAAGATGGCTCTGGATATAGAGATAGCC
GCTTACAGAAAACTCCTGGAAGGTGAAGAGTGTCGGATTGGCTTTGGCCCAATTCCTTTC
TCGCTTCCAGAAGGACTCCCCAAAATTCCCTCTGTGTCCACTCACATAAAGGTGAAAAGC
GAAGAGAAGATCAAAGTGGTGGAGAAGTCTGAGAAAGAAACTGTGATTGTGGAGGAACAG
ACAGAGGAGACCCAAGTGACTGAAGAAGTGACTGAAGAAGAGGAGAAAGAGGCCAAAGAG
GAGGAGGGCAAGGAGGAAGAAGGGGGTGAAGAAGAGGAGGCAGAAGGGGGAGAAGAAGAA
ACAAAGTCTCCCCCAGCAGAAGAGGCTGCATCCCCAGAGAAGGAAGCCAAGTCACCAGTA
AAGGAAGAGGCAAAGTCACCGGCTGAGGCCAAGTCCCCAGAGAAGGAGGAAGCAAAATCC
CCAGCCGAAGTCAAGTCCCCTGAGAAGGCCAAGTCTCCAGCAAAGGAAGAGGCAAAGTCA
CCGCCTGAGGCCAAGTCCCCAGAGAAGGAGGAAGCAAAATCTCCAGCTGAGGTCAAGTCC
CCCGAGAAGGCCAAGTCCCCAGCAAAGGAAGAGGCAAAGTCACCGGCTGAGGCCAAGTCT
CCAGAGAAGGCCAAGTCCCCAGTGAAGGAAGAAGCAAAGTCACCGGCTGAGGCCAAGTCC
CCAGTGAAGGAAGAAGCAAAATCTCCAGCTGAGGTCAAGTCCCCGGAAAAGGCCAAGTCT
CCAACGAAGGAGGAAGCAAAGTCCCCTGAGAAGGCCAAGTCCCCAGAGAAGGAAGAGGCC
AAGTCCCCTGAGAAGGCCAAGTCCCCAGTGAAGGCAGAAGCAAAGTCCCCTGAGAAGGCC
AAGTCCCCAGTGAAGGCAGAAGCAAAGTCCCCTGAGAAGGCCAAGTCCCCAGTGAAGGAA
GAAGCAAAGTCCCCTGAGAAGGCCAAGTCCCCAGTGAAGGAAGAAGCAAAGTCCCCTGAG
AAGGCCAAGTCCCCAGTGAAGGAAGAAGCAAAGACCCCCGAGAAGGCCAAGTCCCCAGTG
AAGGAAGAAGCTAAGTCCCCAGAGAAGGCCAAGTCCCCAGAGAAGGCCAAGACTCTTGAT
GTGAAGTCTCCAGAAGCCAAGACTCCAGCGAAGGAGGAAGCAAGGTCCCCTGCAGACAAA
TTCCCTGAAAAGGCCAAAAGCCCTGTCAAGGAGGAGGTCAAGTCCCCAGAGAAGGCGAAA
TCTCCCCTGAAGGAGGATGCCAAGGCCCCTGAGAAGGAGATCCCAAAAAAGGAAGAGGTG
AAGTCCCCAGTGAAGGAGGAGGAGAAGCCCCAGGAGGTGAAAGTCAAAGAGCCCCCAAAG
AAGGCAGAGGAAGAGAAAGCCCCTGCCACACCAAAAACAGAGGAGAAGAAGGACAGCAAG
AAAGAGGAGGCACCCAAGAAGGAGGCTCCAAAGCCCAAGGTGGAGGAGAAGAAGGAACCT
GCTGTCGAAAAGCCCAAAGAATCCAAAGTTGAAGCCAAGAAGGAAGAGGCTGAAGATAAG
AAAAAAGTCCCCACCCCAGAGAAGGAGGCTCCTGCCAAGGTGGAGGTGAAGGAAGACGCT
AAACCCAAAGAAAAGACAGAGGTAGCCAAGAAGGAACCAGATGATGCCAAGGCCAAGGAA
CCCAGCAAACCAGCAGAGAAGAAGGAGGCAGCACCGGAGAAAAAAGACACCAAGGAGGAG
AAGGCCAAGAAGCCTGAGGAGAAACCCAAGACAGAGGCCAAAGCCAAGGAAGATGACAAG
ACCCTCTCAAAAGAGCCTAGCAAGCCTAAGGCAGAAAAGGCTGAAAAATCCTCCAGCACA
GACCAAAAAGACAGCAAGCCTCCAGAGAAGGCCACAGAAGACAAGGCCGCCAAGGGGAAG
TAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:7737
Chromosome Location22
LocusNot Available
References
  1. Lees JF, Shneidman PS, Skuntz SF, Carden MJ, Lazzarini RA: The structure and organization of the human heavy neurofilament subunit (NF-H) and the gene encoding it. EMBO J. 1988 Jul;7(7):1947-55. 3138108
  2. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. 10048485
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Mukai H, Toshimori M, Shibata H, Kitagawa M, Shimakawa M, Miyahara M, Sunakawa H, Ono Y: PKN associates and phosphorylates the head-rod domain of neurofilament protein. J Biol Chem. 1996 Apr 19;271(16):9816-22. 8621664
  7. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  8. Figlewicz DA, Krizus A, Martinoli MG, Meininger V, Dib M, Rouleau GA, Julien JP: Variants of the heavy neurofilament subunit are associated with the development of amyotrophic lateral sclerosis. Hum Mol Genet. 1994 Oct;3(10):1757-61. 7849698