You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePOU domain, class 2, transcription factor 1
Synonyms
  • NF-A1
  • Oct-1
  • OCT1
  • Octamer-binding protein 1
  • Octamer-binding transcription factor 1
  • OTF-1
  • OTF1
Gene NamePOU2F1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009276|POU domain, class 2, transcription factor 1
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
NSLFTVASASGAASTTTTASKAQ
Number of residues743
Molecular Weight76470.82
Theoretical pINot Available
GO Classification
Functions
  • transcription factor activity, sequence-specific DNA binding
  • transcription regulatory region sequence-specific DNA binding
  • chromatin binding
  • sequence-specific DNA binding
Processes
  • negative regulation of transcription, DNA-templated
  • liver regeneration
  • transcription from RNA polymerase III promoter
  • gene expression
Components
  • nucleus
  • endoplasmic reticulum
  • nucleoplasm
  • intracellular membrane-bounded organelle
General FunctionTranscription regulatory region sequence-specific dna binding
Specific FunctionTranscription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP14859
UniProtKB Entry NamePO2F1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021737|POU domain, class 2, transcription factor 1 (POU2F1)
ATGCTGGACTGCAGTGACTATGTTCTAGACTCAAGAATGAACAATCCGTCAGAAACCAGT
AAACCATCTATGGAGAGTGGAGATGGCAACACAGGCACACAAACCAATGGTCTGGACTTT
CAGAAGCAGCCTGTGCCTGTAGGAGGAGCAATCTCAACAGCCCAGGCGCAGGCTTTCCTT
GGACATCTCCATCAGGTCCAACTCGCTGGAACAAGTTTACAGGCTGCTGCTCAGTCTTTA
AATGTACAGTCTAAATCTAATGAAGAATCGGGGGATTCGCAGCAGCCAAGCCAGCCTTCC
CAGCAGCCTTCAGTGCAGGCAGCCATTCCCCAGACCCAGCTTATGCTAGCTGGAGGACAG
ATAACTGGGCTTACTTTGACGCCTGCCCAGCAACAGTTACTACTCCAGCAGGCACAGGCA
CAGGCACAGCTGCTGGCTGCTGCAGTGCAGCAGCACTCCGCCAGCCAGCAGCACAGTGCT
GCTGGAGCCACCATCTCCGCCTCTGCTGCCACGCCCATGACGCAGATCCCCCTGTCTCAG
CCCATACAGATCGCACAGGATCTTCAACAACTGCAACAGCTTCAACAGCAGAATCTCAAC
CTGCAACAGTTTGTGTTGGTGCATCCAACCACCAATTTGCAGCCAGCGCAGTTTATCATC
TCACAGACGCCCCAGGGCCAGCAGGGTCTCCTGCAAGCGCAAAATCTTCTAACGCAACTA
CCTCAGCAAAGCCAAGCCAACCTCCTACAGTCGCAGCCAAGCATCACCCTCACCTCCCAG
CCAGCAACCCCAACACGCACAATAGCAGCAACCCCAATTCAGACACTTCCACAGAGCCAG
TCAACACCAAAGCGAATTGATACTCCCAGCTTGGAGGAGCCCAGTGACCTTGAGGAGCTT
GAGCAGTTTGCCAAGACCTTCAAACAAAGACGAATCAAACTTGGATTCACTCAGGGTGAT
GTTGGGCTCGCTATGGGGAAACTATATGGAAATGACTTCAGCCAAACTACCATCTCTCGA
TTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTGAAGCCACTTTTAGAGAAG
TGGCTAAATGATGCAGAGAACCTCTCATCTGATTCGTCCCTCTCCAGCCCAAGTGCCCTG
AATTCTCCAGGAATTGAGGGCTTGAGCCGTAGGAGGAAGAAACGCACCAGCATAGAGACC
AACATCCGTGTGGCCTTAGAGAAGAGTTTCTTGGAGAATCAAAAGCCTACCTCGGAAGAG
ATCACTATGATTGCTGATCAGCTCAATATGGAAAAAGAGGTGATTCGTGTTTGGTTCTGT
AACCGCCGCCAGAAAGAAAAAAGAATCAACCCACCAAGCAGTGGTGGGACCAGCAGCTCA
CCTATTAAAGCAATTTTCCCCAGCCCAACTTCACTGGTGGCGACCACACCAAGCCTTGTG
ACTAGCAGTGCAGCAACTACCCTCACAGTCAGCCCTGTCCTCCCTCTGACCAGTGCTGCT
GTGACGAATCTTTCAGTTACAGGCACTTCAGACACCACCTCCAACAACACAGCAACCGTG
ATTTCCACAGCGCCTCCAGCTTCCTCAGCAGTCACGTCCCCCTCTCTGAGTCCCTCCCCT
TCTGCCTCAGCCTCCACCTCCGAGGCATCCAGTGCCAGTGAGACCAGCACAACACAGACC
ACCTCCACTCCTTTGTCCTCCCCTCTTGGGACCAGCCAGGTGATGGTGACAGCATCAGGT
TTGCAAACAGCAGCAGCTGCTGCCCTTCAAGGAGCTGCACAGTTGCCAGCAAATGCCAGT
CTTGCTGCCATGGCAGCTGCTGCAGGACTAAACCCAAGCCTGATGGCACCCTCACAGTTT
GCGGCTGGAGGTGCCTTACTCAGTCTGAATCCAGGGACCCTGAGCGGTGCTCTCAGCCCA
GCTCTAATGAGCAACAGTACACTGGCAACTATTCAAGCTCTTGCTTCTGGTGGCTCTCTT
CCAATAACATCACTTGATGCAACTGGGAACCTGGTATTTGCCAATGCGGGAGGAGCCCCC
AACATCGTGACTGCCCCTCTGTTCCTGAACCCTCAGAACCTCTCTCTGCTCACCAGCAAC
CCTGTTAGCTTGGTCTCTGCCGCCGCAGCATCTGCAGGGAACTCTGCACCTGTAGCCAGC
CTTCACGCCACCTCCACCTCTGCTGAGTCCATCCAGAACTCTCTCTTCACAGTGGCCTCT
GCCAGCGGGGCTGCGTCCACCACCACCACCGCCTCCAAGGCACAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9212
Chromosome Location1
LocusNot Available
References
  1. Sturm RA, Das G, Herr W: The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain. Genes Dev. 1988 Dec;2(12A):1582-99. 2905684
  2. Luchina NN, Krivega IV, Pankratova EV: Human Oct-1L isoform has tissue-specific expression pattern similar to Oct-2. Immunol Lett. 2003 Feb 3;85(3):237-41. 12663137
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Segil N, Roberts SB, Heintz N: Mitotic phosphorylation of the Oct-1 homeodomain and regulation of Oct-1 DNA binding activity. Science. 1991 Dec 20;254(5039):1814-6. 1684878
  7. Prefontaine GG, Walther R, Giffin W, Lemieux ME, Pope L, Hache RJ: Selective binding of steroid hormone receptors to octamer transcription factors determines transcriptional synergism at the mouse mammary tumor virus promoter. J Biol Chem. 1999 Sep 17;274(38):26713-9. 10480874
  8. Mahajan SS, Wilson AC: Mutations in host cell factor 1 separate its role in cell proliferation from recruitment of VP16 and LZIP. Mol Cell Biol. 2000 Feb;20(3):919-28. 10629049
  9. Schild-Poulter C, Shih A, Yarymowich NC, Hache RJ: Down-regulation of histone H2B by DNA-dependent protein kinase in response to DNA damage through modulation of octamer transcription factor 1. Cancer Res. 2003 Nov 1;63(21):7197-205. 14612514
  10. Wysocka J, Herr W: The herpes simplex virus VP16-induced complex: the makings of a regulatory switch. Trends Biochem Sci. 2003 Jun;28(6):294-304. 12826401
  11. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  12. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  13. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  14. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  15. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  16. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  17. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  18. Dekker N, Cox M, Boelens R, Verrijzer CP, van der Vliet PC, Kaptein R: Solution structure of the POU-specific DNA-binding domain of Oct-1. Nature. 1993 Apr 29;362(6423):852-5. 8479524
  19. Assa-Munt N, Mortishire-Smith RJ, Aurora R, Herr W, Wright PE: The solution structure of the Oct-1 POU-specific domain reveals a striking similarity to the bacteriophage lambda repressor DNA-binding domain. Cell. 1993 Apr 9;73(1):193-205. 8462099
  20. Cox M, van Tilborg PJ, de Laat W, Boelens R, van Leeuwen HC, van der Vliet PC, Kaptein R: Solution structure of the Oct-1 POU homeodomain determined by NMR and restrained molecular dynamics. J Biomol NMR. 1995 Jul;6(1):23-32. 7663141
  21. Klemm JD, Rould MA, Aurora R, Herr W, Pabo CO: Crystal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules. Cell. 1994 Apr 8;77(1):21-32. 8156594
  22. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974