You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSerine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Synonyms
  • 3.1.3.16
  • Calmodulin-dependent calcineurin A subunit beta isoform
  • CALNA2
  • CALNB
  • CAM-PRP catalytic subunit
  • CNA2
Gene NamePPP3CB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008846|Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Number of residues524
Molecular Weight59023.735
Theoretical pINot Available
GO Classification
Functions
  • calmodulin binding
  • protein serine/threonine phosphatase activity
  • calcium ion binding
  • protein dimerization activity
  • enzyme binding
  • calmodulin-dependent protein phosphatase activity
  • protein phosphatase 2B binding
  • drug binding
Processes
  • positive regulation of insulin secretion involved in cellular response to glucose stimulus
  • learning
  • signal transduction
  • social behavior
  • T cell homeostasis
  • axon extension
  • memory
  • T cell differentiation
  • cellular response to drug
  • negative regulation of T cell mediated cytotoxicity
  • T cell activation
  • protein dephosphorylation
  • T cell proliferation
  • response to cytokine
  • innate immune response
  • Fc-epsilon receptor signaling pathway
  • locomotion involved in locomotory behavior
  • calcineurin-NFAT signaling cascade
  • positive regulation of transcription, DNA-templated
  • positive regulation of NFAT protein import into nucleus
  • heart development
  • regulation of synaptic plasticity
  • positive regulation of transcription from RNA polymerase II promoter
  • lymphangiogenesis
  • protein phosphorylation
  • calcium ion-dependent exocytosis
  • stimulatory C-type lectin receptor signaling pathway
  • dephosphorylation
  • regulation of insulin secretion
Components
  • T-tubule
  • Z disc
  • plasma membrane
  • cytosol
  • nucleoplasm
  • calcineurin complex
General FunctionProtein serine/threonine phosphatase activity
Specific FunctionCalcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP16298
UniProtKB Entry NamePP2BB_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0019674|Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (PPP3CB)
ATGGCCGCCCCGGAGCCGGCCCGGGCTGCACCGCCCCCACCCCCGCCCCCGCCGCCCCCT
CCCGGGGCTGACCGCGTCGTCAAAGCTGTCCCTTTCCCCCCAACACATCGCTTGACATCT
GAAGAAGTATTTGATTTGGATGGGATACCCAGGGTTGATGTTCTGAAGAACCACTTGGTG
AAAGAAGGTCGAGTAGATGAAGAAATTGCGCTTAGAATTATCAATGAGGGTGCTGCCATC
CTTCGGAGAGAGAAAACCATGATAGAAGTAGAAGCTCCAATCACAGTGTGTGGTGACATC
CATGGCCAATTTTTTGATCTGATGAAACTTTTTGAAGTAGGAGGATCACCTGCTAATACA
CGATACCTTTTTCTTGGCGATTATGTGGACAGAGGTTATTTTAGTATAGAGTGTGTCTTA
TATTTATGGGTTCTGAAGATTCTATACCCAAGCACATTATTTCTTCTGAGAGGCAACCAT
GAATGCAGACACCTTACTGAATATTTTACCTTTAAGCAGGAATGTAAAATTAAGTATTCG
GAAAGAGTCTATGAAGCTTGTATGGAAGCTTTTGATAGTTTGCCTCTTGCTGCACTTTTA
AACCAACAGTTTCTTTGTGTTCATGGTGGACTTTCACCAGAAATACACACACTGGATGAT
ATTAGGAGATTAGATAGATTCAAAGAGCCACCTGCATTTGGACCAATGTGTGACTTGTTA
TGGTCCGATCCTTCTGAAGATTTTGGAAATGAAAAATCACAGGAACATTTTAGTCACAAT
ACAGTTCGAGGATGTTCTTATTTTTATAACTATCCAGCAGTGTGTGAATTTTTGCAAAAC
AATAATTTGTTATCGATTATTAGAGCTCATGAAGCTCAAGATGCAGGCTATAGAATGTAC
AGAAAAAGTCAAACTACAGGGTTCCCTTCATTAATAACAATTTTTTCGGCACCTAATTAC
TTAGATGTCTACAATAATAAAGCTGCTGTATTAAAGTATGAAAATAATGTGATGAATATT
CGACAGTTTAACTGTTCTCCACATCCTTACTGGTTGCCTAATTTTATGGATGTCTTCACG
TGGTCTTTACCGTTTGTTGGAGAAAAAGTGACAGAAATGTTGGTAAATGTTCTGAGTATT
TGCTCTGATGATGAACTAATGACTGAAGGTGAAGACCAGTTTGATGTAGGTTCAGCTGCA
GCCCGGAAAGAAATCATAAGAAACAAAATTCGAGCAATTGGCAAGATGGCAAGAGTCTTC
TCTGTTCTCAGGGAGGAGAGTGAAAGTGTGCTGACACTCAAGGGCCTGACTCCCACAGGG
ATGTTGCCTAGTGGAGTGTTAGCTGGAGGACGGCAGACCCTGCAAAGTGCCACAGTTGAG
GCTATTGAGGCTGAAAAAGCAATACGAGGATTCTCTCCACCACATAGAATCTGCAGTTTT
GAAGAGGCAAAGGGTTTGGATAGGATCAATGAGAGAATGCCACCTCGGAAAGATGCTGTA
CAGCAAGATGGTTTCAATTCTCTGAACACCGCACATGCCACTGAGAACCACGGGACGGGC
AACCATACTGCCCAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9315
Chromosome Location10
LocusNot Available
References
  1. Guerini D, Klee CB: Cloning of human calcineurin A: evidence for two isozymes and identification of a polyproline structural domain. Proc Natl Acad Sci U S A. 1989 Dec;86(23):9183-7. 2556704
  2. McPartlin AE, Barker HM, Cohen PT: Identification of a third alternatively spliced cDNA encoding the catalytic subunit of protein phosphatase 2B beta. Biochim Biophys Acta. 1991 Feb 16;1088(2):308-10. 1848109
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330