You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameE-selectin
Synonyms
  • CD62 antigen-like family member E
  • ELAM-1
  • ELAM1
  • Endothelial leukocyte adhesion molecule 1
  • LECAM2
  • Leukocyte-endothelial cell adhesion molecule 2
Gene NameSELE
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010753|E-selectin
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
Number of residues610
Molecular Weight66654.575
Theoretical pI4.94
GO Classification
Functions
  • oligosaccharide binding
  • phospholipase binding
  • sialic acid binding
  • transmembrane signaling receptor activity
Processes
  • leukocyte tethering or rolling
  • actin filament-based process
  • leukocyte migration involved in inflammatory response
  • response to tumor necrosis factor
  • leukocyte migration
  • calcium-mediated signaling
  • regulation of inflammatory response
  • positive regulation of receptor internalization
  • response to lipopolysaccharide
  • activation of phospholipase C activity
  • blood coagulation
  • response to interleukin-1
  • positive regulation of leukocyte migration
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
  • inflammatory response
  • leukocyte cell-cell adhesion
Components
  • coated pit
  • integral component of membrane
  • cortical cytoskeleton
  • perinuclear region of cytoplasm
  • membrane raft
  • caveola
  • plasma membrane
  • extracellular space
General FunctionTransmembrane signaling receptor activity
Specific FunctionCell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
Pfam Domain Function
Transmembrane Regions557-578
GenBank Protein ID182048
UniProtKB IDP16581
UniProtKB Entry NameLYAM2_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010754|E-selectin (SELE)
ATGATTGCTTCACAGTTTCTCTCAGCTCTCACTTTGGTGCTTCTCATTAAAGAGAGTGGA
GCCTGGTCTTACAACACCTCCACGGAAGCTATGACTTATGATGAGGCCAGTGCTTATTGT
CAGCAAAGGTACACACACCTGGTTGCAATTCAAAACAAAGAAGAGATTGAGTACCTAAAC
TCCATATTGAGCTATTCACCAAGTTATTACTGGATTGGAATCAGAAAAGTCAACAATGTG
TGGGTCTGGGTAGGAACCCAGAAACCTCTGACAGAAGAAGCCAAGAACTGGGCTCCAGGT
GAACCCAACAATAGGCAAAAAGATGAGGACTGCGTGGAGATCTACATCAAGAGAGAAAAA
GATGTGGGCATGTGGAATGATGAGAGGTGCAGCAAGAAGAAGCTTGCCCTATGCTACACA
GCTGCCTGTACCAATACATCCTGCAGTGGCCACGGTGAATGTGTAGAGACCATCAATAAT
TACACTTGCAAGTGTGACCCTGGCTTCAGTGGACTCAAGTGTGAGCAAATTGTGAACTGT
ACAGCCCTGGAATCCCCTGAGCATGGAAGCCTGGTTTGCAGTCACCCACTGGGAAACTTC
AGCTACAATTCTTCCTGCTCTATCAGCTGTGATAGGGGTTACCTGCCAAGCAGCATGGAG
ACCATGCAGTGTATGTCCTCTGGAGAATGGAGTGCTCCTATTCCAGCCTGCAATGTGGTT
GAGTGTGATGCTGTGACAAATCCAGCCAATGGGTTCGTGGAATGTTTCCAAAACCCTGGA
AGCTTCCCATGGAACACAACCTGTACATTTGACTGTGAAGAAGGATTTGAACTAATGGGA
GCCCAGAGCCTTCAGTGTACCTCATCTGGGAATTGGGACAACGAGAAGCCAACGTGTAAA
GCTGTGACATGCAGGGCCGTCCGCCAGCCTCAGAATGGCTCTGTGAGGTGCAGCCATTCC
CCTGCTGGAGAGTTCACCTTCAAATCATCCTGCAACTTCACCTGTGAGGAAGGCTTCATG
TTGCAGGGACCAGCCCAGGTTGAATGCACCACTCAAGGGCAGTGGACACAGCAAATCCCA
GTTTGTGAAGCTTTCCAGTGCACAGCCTTGTCCAACCCCGAGCGAGGCTACATGAATTGT
CTTCCTAGTGCTTCTGGCAGTTTCCGTTATGGGTCCAGCTGTGAGTTCTCCTGTGAGCAG
GGTTTTGTGTTGAAGGGATCCAAAAGGCTCCAATGTGGCCCCACAGGGGAGTGGGACAAC
GAGAAGCCCACATGTGAAGCTGTGAGATGCGATGCTGTCCACCAGCCCCCGAAGGGTTTG
GTGAGGTGTGCTCATTCCCCTATTGGAGAATTCACCTACAAGTCCTCTTGTGCCTTCAGC
TGTGAGGAGGGATTTGAATTACATGGATCAACTCAACTTGAGTGCACATCTCAGGGACAA
TGGACAGAAGAGGTTCCTTCCTGCCAAGTGGTAAAATGTTCAAGCCTGGCAGTTCCGGGA
AAGATCAACATGAGCTGCAGTGGGGAGCCCGTGTTTGGCACTGTGTGCAAGTTCGCCTGT
CCTGAAGGATGGACGCTCAATGGCTCTGCAGCTCGGACATGTGGAGCCACAGGACACTGG
TCTGGCCTGCTACCTACCTGTGAAGCTCCCACTGAGTCCAACATTCCCTTGGTAGCTGGA
CTTTCTGCTGCTGGACTCTCCCTCCTGACATTAGCACCATTTCTCCTCTGGCTTCGGAAA
TGCTTACGGAAAGCAAAGAAATTTGTTCCTGCCAGCAGCTGCCAAAGCCTTGAATCAGAT
GGAAGCTACCAAAAGCCTTCTTACATCCTTTAA
GenBank Gene IDM30640
GeneCard IDNot Available
GenAtlas IDSELE
HGNC IDHGNC:10718
Chromosome Location1
Locus1q22-q25
References
  1. Hession C, Osborn L, Goff D, Chi-Rosso G, Vassallo C, Pasek M, Pittack C, Tizard R, Goelz S, McCarthy K, et al.: Endothelial leukocyte adhesion molecule 1: direct expression cloning and functional interactions. Proc Natl Acad Sci U S A. 1990 Mar;87(5):1673-7. 1689848
  2. Bevilacqua MP, Stengelin S, Gimbrone MA Jr, Seed B: Endothelial leukocyte adhesion molecule 1: an inducible receptor for neutrophils related to complement regulatory proteins and lectins. Science. 1989 Mar 3;243(4895):1160-5. 2466335
  3. Collins T, Williams A, Johnston GI, Kim J, Eddy R, Shows T, Gimbrone MA Jr, Bevilacqua MP: Structure and chromosomal location of the gene for endothelial-leukocyte adhesion molecule 1. J Biol Chem. 1991 Feb 5;266(4):2466-73. 1703529
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Phillips ML, Nudelman E, Gaeta FC, Perez M, Singhal AK, Hakomori S, Paulson JC: ELAM-1 mediates cell adhesion by recognition of a carbohydrate ligand, sialyl-Lex. Science. 1990 Nov 23;250(4984):1130-2. 1701274
  7. Kerr SC, Fieger CB, Snapp KR, Rosen SD: Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins. J Immunol. 2008 Jul 15;181(2):1480-90. 18606703
  8. Mills A: Modelling the carbohydrate recognition domain of human E-selectin. FEBS Lett. 1993 Mar 15;319(1-2):5-11. 7681016
  9. Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK: Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains. Nature. 1994 Feb 10;367(6463):532-8. 7509040
  10. Somers WS, Tang J, Shaw GD, Camphausen RT: Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1. Cell. 2000 Oct 27;103(3):467-79. 11081633
  11. Wenzel K, Felix S, Kleber FX, Brachold R, Menke T, Schattke S, Schulte KL, Glaser C, Rohde K, Baumann G, et al.: E-selectin polymorphism and atherosclerosis: an association study. Hum Mol Genet. 1994 Nov;3(11):1935-7. 7533025
  12. Wenzel K, Ernst M, Rohde K, Baumann G, Speer A: DNA polymorphisms in adhesion molecule genes--a new risk factor for early atherosclerosis. Hum Genet. 1996 Jan;97(1):15-20. 8557254
  13. Ye SQ, Usher D, Virgil D, Zhang LQ, Yochim SE, Gupta R: A PstI polymorphism detects the mutation of serine128 to arginine in CD 62E gene - a risk factor for coronary artery disease. J Biomed Sci. 1999 Jan;6(1):18-21. 9933738
  14. Halushka MK, Fan JB, Bentley K, Hsie L, Shen N, Weder A, Cooper R, Lipshutz R, Chakravarti A: Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis. Nat Genet. 1999 Jul;22(3):239-47. 10391210
  15. Sass C, Pallaud C, Zannad F, Visvikis S: Relationship between E-selectin L/F554 polymorphism and blood pressure in the Stanislas cohort. Hum Genet. 2000 Jul;107(1):58-61. 10982036
  16. Yoshida M, Takano Y, Sasaoka T, Izumi T, Kimura A: E-selectin polymorphism associated with myocardial infarction causes enhanced leukocyte-endothelial interactions under flow conditions. Arterioscler Thromb Vasc Biol. 2003 May 1;23(5):783-8. Epub 2003 Mar 20. 12649084
  17. Preston RC, Rabbani S, Binder FP, Moes S, Magnani JL, Ernst B: Implications of the E-selectin S128R mutation for drug discovery. Glycobiology. 2014 Jul;24(7):592-601. doi: 10.1093/glycob/cwu026. Epub 2014 Mar 31. 24688092
  18. Cromer MK, Choi M, Nelson-Williams C, Fonseca AL, Kunstman JW, Korah RM, Overton JD, Mane S, Kenney B, Malchoff CD, Stalberg P, Akerstrom G, Westin G, Hellman P, Carling T, Bjorklund P, Lifton RP: Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas. Proc Natl Acad Sci U S A. 2015 Mar 31;112(13):4062-7. doi: 10.1073/pnas.1503696112. Epub 2015 Mar 18. 25787250