You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePotassium voltage-gated channel subfamily A member 6
Synonyms
  • Voltage-gated potassium channel HBK2
  • Voltage-gated potassium channel subunit Kv1.6
Gene NameKCNA6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013278|Potassium voltage-gated channel subfamily A member 6
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITP
GEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIID
LVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV
TCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV
Number of residues529
Molecular Weight58728.21
Theoretical pINot Available
GO Classification
Functions
  • delayed rectifier potassium channel activity
  • voltage-gated potassium channel activity
Processes
  • potassium ion transport
  • synaptic transmission
  • potassium ion transmembrane transport
  • protein homooligomerization
Components
  • plasma membrane
  • voltage-gated potassium channel complex
  • integral component of plasma membrane
  • axon terminus
  • potassium channel complex
General FunctionVoltage-gated potassium channel activity
Specific FunctionVoltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient (PubMed:2347305, PubMed:14575698). The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (PubMed:2347305, PubMed:14575698). Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA6, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel (By similarity). Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation (By similarity). Homotetrameric channels display rapid activation and slow inactivation (PubMed:2347305).
Pfam Domain Function
Transmembrane Regions172-193 263-284 296-316 338-358 374-395 437-465
GenBank Protein IDNot Available
UniProtKB IDP17658
UniProtKB Entry NameKCNA6_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0013279|Potassium voltage-gated channel subfamily A member 6 (KCNA6)
ATGAGATCGGAGAAATCCCTTACGCTGGCGGCGCCGGGGGAGGTCCGTGGGCCGGAGGGA
GAGCAACAGGATGCGGGAGACTTCCCGGAGGCCGGCGGGGGCGGGGGCTGCTGTAGTAGC
GAGCGGCTGGTGATCAATATCTCCGGGCTGCGCTTTGAGACACAATTGCGCACCCTGTCG
CTGTTTCCGGACACGCTGCTCGGAGACCCTGGCCGGCGAGTCCGCTTCTTCGACCCCCTG
AGGAACGAGTACTTCTTCGACCGCAACCGGCCCAGCTTCGACGCCATCCTCTACTACTAC
CAGTCTGGGGGCCGCCTGCGGAGGCCGGTCAACGTGCCCCTGGACATTTTCCTGGAGGAG
ATCCGCTTCTACCAGCTGGGGGACGAGGCCCTGGCGGCCTTCCGGGAGGACGAGGGCTGC
CTGCCCGAAGGTGGCGAGGACGAGAAGCCGCTGCCCTCCCAGCCCTTCCAGCGCCAGGTG
TGGCTGCTCTTTGAGTACCCAGAGAGCTCTGGGCCGGCCAGGGGCATCGCCATCGTCTCC
GTGTTGGTCATTCTCATCTCCATAGTCATCTTTTGCCTGGAGACCTTACCCCAGTTCCGT
GTAGATGGTCGAGGTGGAAACAATGGTGGTGTGAGTCGAGTCTCCCCAGTTTCCAGGGGG
AGTCAGGAGGAAGAGGAGGATGAAGACGATTCCTACACATTTCATCATGGCATCACCCCT
GGGGAAATGGGGACCGGGGGCTCCTCCTCACTCAGTACTCTTGGGGGCTCCTTCTTTACA
GACCCCTTCTTTCTGGTGGAGACGCTGTGCATTGTCTGGTTCACTTTTGAGCTCCTGGTG
CGCTTCTCCGCCTGCCCTAGCAAGCCGGCCTTCTTCCGGAACATCATGAACATCATTGAC
TTGGTGGCTATCTTCCCCTACTTCATCACCCTGGGCACTGAGCTGGTGCAGCAGCAGGAG
CAGCAACCAGCCAGTGGAGGAGGCGGCCAGAATGGGCAGCAGGCCATGTCCCTGGCCATC
CTCCGAGTCATCCGCCTGGTCCGGGTGTTCCGCATCTTCAAGCTCTCCCGCCACTCCAAG
GGGCTGCAGATCCTGGGCAAGACCTTGCAGGCCTCCATGAGGGAGCTGGGGCTGCTCATC
TTCTTCCTCTTCATCGGGGTCATCCTCTTCTCCAGTGCCGTCTACTTCGCAGAGGCTGAC
GATGACGATTCGCTTTTTCCCAGCATCCCGGATGCCTTCTGGTGGGCAGTGGTTACAATG
ACCACGGTAGGTTACGGGGACATGTACCCCATGACTGTGGGGGGAAAGATCGTGGGCTCG
CTGTGTGCCATCGCTGGGGTCCTCACCATTGCCCTGCCTGTGCCCGTCATCGTCTCCAAC
TTCAACTACTTCTACCACCGGGAGACGGAGCAGGAGGAGCAAGGCCAGTATACCCACGTC
ACTTGTGGGCAGCCTGCGCCGGACCTGAGGGCAACTGACAACGGACTTGGCAAGCCTGAC
TTCCCCGAGGCTAACCGGGAACGGAGACCCAGCTACCTTCCTACACCACATCGGGCCTAT
GCAGAGAAAAGAATGCTCACGGAGGTCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6225
Chromosome Location12
LocusNot Available
References
  1. Grupe A, Schroter KH, Ruppersberg JP, Stocker M, Drewes T, Beckh S, Pongs O: Cloning and expression of a human voltage-gated potassium channel. A novel member of the RCK potassium channel family. EMBO J. 1990 Jun;9(6):1749-56. 2347305
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Guihard G, Bellocq C, Grelet E, Escande D: Human Kv1.6 current displays a C-type-like inactivation when re-expressed in cos-7 cells. Biochem Biophys Res Commun. 2003 Nov 7;311(1):83-9. 14575698