You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit beta-2
Synonyms
  • Neuronal acetylcholine receptor subunit beta-2 precursor
Gene NameCHRNB2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010600|Neuronal acetylcholine receptor subunit beta-2
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
Number of residues502
Molecular Weight57018.575
Theoretical pI6.77
GO Classification
Functions
  • drug binding
  • acetylcholine binding
  • ligand-gated ion channel activity
  • acetylcholine-activated cation-selective channel activity
  • acetylcholine receptor activity
Processes
  • protein heterooligomerization
  • lateral geniculate nucleus development
  • response to ethanol
  • optic nerve morphogenesis
  • positive regulation of B cell proliferation
  • ion transport
  • response to nicotine
  • smooth muscle contraction
  • positive regulation of dopamine secretion
  • calcium ion transport
  • regulation of membrane potential
  • synaptic transmission, cholinergic
  • positive regulation of synaptic transmission, dopaminergic
  • signal transduction
  • visual learning
  • locomotory behavior
  • regulation of circadian sleep/wake cycle, non-REM sleep
  • cation transmembrane transport
  • cognition
  • regulation of circadian sleep/wake cycle, REM sleep
  • neurological system process
  • neuromuscular synaptic transmission
  • regulation of dendrite morphogenesis
  • regulation of dopamine metabolic process
  • negative regulation of action potential
  • synaptic transmission
  • sensory perception of pain
  • visual perception
  • associative learning
  • regulation of dopamine secretion
  • regulation of synapse assembly
  • learning
  • action potential
  • regulation of synaptic transmission, dopaminergic
  • response to cocaine
  • B cell activation
  • synaptic transmission involved in micturition
  • social behavior
  • sensory perception of sound
  • behavioral response to nicotine
  • vestibulocochlear nerve development
  • membrane depolarization
  • ion transmembrane transport
  • central nervous system projection neuron axonogenesis
  • memory
  • response to hypoxia
  • conditioned taste aversion
Components
  • synapse
  • neuron projection
  • postsynaptic membrane
  • plasma membrane
  • acetylcholine-gated channel complex
  • cell junction
  • integral component of membrane
  • external side of plasma membrane
General FunctionLigand-gated ion channel activity
Specific FunctionAfter binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions.
Pfam Domain Function
Transmembrane Regions234-258 266-284 300-321 459-478
GenBank Protein ID32017
UniProtKB IDP17787
UniProtKB Entry NameACHB2_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0010601|Neuronal acetylcholine receptor subunit beta-2 (CHRNB2)
ATGGCCCGGCGCTGCGGCCCCGTGGCGCTGCTCCTTGGCTTCGGCCTCCTCCGGCTGTGC
TCAGGGGTGTGGGGTACGGATACAGAGGAGCGGCTGGTGGAGCATCTCCTGGATCCTTCC
CGCTACAACAAGCTTATCCGCCCAGCCACCAATGGCTCTGAGCTGGTGACAGTACAGCTT
ATGGTGTCACTGGCCCAGCTCATCAGTGTGCATGAGCGGGAGCAGATCATGACCACCAAT
GTCTGGCTGACCCAGGAGTGGGAAGATTATCGCCTCACCTGGAAGCCTGAAGAGTTTGAC
AACATGAAGAAAGTTCGGCTCCCTTCCAAACACATCTGGCTCCCAGATGTGGTCCTGTAC
AACAATGCTGACGGCATGTACGAGGTGTCCTTCTATTCCAATGCCGTGGTCTCCTATGAT
GGCAGCATCTTCTGGCTGCCGCCTGCCATCTACAAGAGCGCATGCAAGATTGAAGTAAAG
CACTTCCCATTTGACCAGCAGAACTGCACCATGAAGTTCCGTTCGTGGACCTACGACCGC
ACAGAGATCGACTTGGTGCTGAAGAGTGAGGTGGCCAGCCTGGACGACTTCACACCTAGT
GGTGAGTGGGACATCGTGGCGCTGCCGGGCCGGCGCAACGAGAACCCCGACGACTCTACG
TACGTGGACATCACGTATGACTTCATCATTCGCCGCAAGCCGCTCTTCTACACCATCAAC
CTCATCATCCCCTGTGTGCTCATCACCTCGCTAGCCATCCTTGTCTTCTACCTGCCATCC
GACTGTGGCGAGAAGATGACGTTGTGCATCTCAGTGCTGCTGGCGCTCACGGTCTTCCTG
CTGCTCATCTCCAAGATCGTGCCTCCCACCTCCCTCGACGTGCCGCTCGTCGGCAAGTAC
CTCATGTTCACCATGGTGCTTGTCACCTTCTCCATCGTCACCAGCGTGTGCGTGCTCAAC
GTGCACCACCGCTCGCCCACCACGCACACCATGGCGCCCTGGGTGAAGGTCGTCTTCCTG
GAGAAGCTGCCCGCGCTGCTCTTCATGCAGCAGCCACGCCATCATTGCGCCCGTCAGCGC
CTGCGCCTGCGGCGACGCCAGCGTGAGCGCGAGGGCGCTGGAGCCCTCTTCTTCCGCGAA
GCCCCAGGGGCCGACTCCTGCACGTGCTTCGTCAACCGCGCGTCGGTGCAGGGGTTGGCC
GGGGCCTTCGGGGCTGAGCCTGCACCAGTGGCGGGCCCCGGGCGCTCAGGGGAGCCGTGT
GGCTGTGGCCTCCGGGAGGCGGTGGACGGCGTGCGCTTCATCGCAGACCACATGCGGAGC
GAGGACGATGACCAGAGCGTGAGTGAGGACTGGAAGTACGTCGCCATGGTGATCGACCGC
CTCTTCCTCTGGATCTTTGTCTTTGTCTGTGTCTTTGGCACCATCGGCATGTTCCTGCAG
CCTCTCTTCCAGAACTACACCACCACCACCTTCCTCCACTCAGACCACTCAGCCCCCAGC
TCCAAGTGA
GenBank Gene IDX53179
GeneCard IDNot Available
GenAtlas IDCHRNB2
HGNC IDHGNC:1962
Chromosome Location1
Locus1q21.3
References
  1. Anand R, Lindstrom J: Nucleotide sequence of the human nicotinic acetylcholine receptor beta 2 subunit gene. Nucleic Acids Res. 1990 Jul 25;18(14):4272. 2377478
  2. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. 8906617
  3. Groot Kormelink PJ, Luyten WH: Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 1997 Jan 6;400(3):309-14. 9009220
  4. Rempel N, Heyers S, Engels H, Sleegers E, Steinlein OK: The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3). Hum Genet. 1998 Dec;103(6):645-53. 9921897
  5. Lueders KK, Elliott RW, Marenholz I, Mischke D, DuPree M, Hamer D: Genomic organization and mapping of the human and mouse neuronal beta2-nicotinic acetylcholine receptor genes. Mamm Genome. 1999 Sep;10(9):900-5. 10441742
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Lansdell SJ, Gee VJ, Harkness PC, Doward AI, Baker ER, Gibb AJ, Millar NS: RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells. Mol Pharmacol. 2005 Nov;68(5):1431-8. Epub 2005 Aug 24. 16120769
  8. Bondarenko V, Tillman T, Xu Y, Tang P: NMR structure of the transmembrane domain of the n-acetylcholine receptor beta2 subunit. Biochim Biophys Acta. 2010 Aug;1798(8):1608-14. doi: 10.1016/j.bbamem.2010.04.014. Epub 2010 May 2. 20441771
  9. Bondarenko V, Mowrey D, Tillman T, Cui T, Liu LT, Xu Y, Tang P: NMR structures of the transmembrane domains of the alpha4beta2 nAChR. Biochim Biophys Acta. 2012 May;1818(5):1261-8. doi: 10.1016/j.bbamem.2012.02.008. Epub 2012 Feb 14. 22361591
  10. De Fusco M, Becchetti A, Patrignani A, Annesi G, Gambardella A, Quattrone A, Ballabio A, Wanke E, Casari G: The nicotinic receptor beta 2 subunit is mutant in nocturnal frontal lobe epilepsy. Nat Genet. 2000 Nov;26(3):275-6. 11062464
  11. Phillips HA, Favre I, Kirkpatrick M, Zuberi SM, Goudie D, Heron SE, Scheffer IE, Sutherland GR, Berkovic SF, Bertrand D, Mulley JC: CHRNB2 is the second acetylcholine receptor subunit associated with autosomal dominant nocturnal frontal lobe epilepsy. Am J Hum Genet. 2001 Jan;68(1):225-31. Epub 2000 Dec 5. 11104662
  12. Lueders KK, Hu S, McHugh L, Myakishev MV, Sirota LA, Hamer DH: Genetic and functional analysis of single nucleotide polymorphisms in the beta2-neuronal nicotinic acetylcholine receptor gene (CHRNB2). Nicotine Tob Res. 2002 Feb;4(1):115-25. 11906688