You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAlpha-2C adrenergic receptor
Synonyms
  • ADRA2L2
  • ADRA2RL2
  • Alpha-2 adrenergic receptor subtype C4
  • Alpha-2C adrenoceptor
  • Alpha-2C adrenoreceptor
  • Alpha-2CAR
Gene NameADRA2C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000681|Alpha-2C adrenergic receptor
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Number of residues462
Molecular Weight49521.585
Theoretical pI10.69
GO Classification
Functions
  • alpha-2A adrenergic receptor binding
  • epinephrine binding
  • protein homodimerization activity
  • protein heterodimerization activity
  • alpha2-adrenergic receptor activity
Processes
  • positive regulation of neuron differentiation
  • cell-cell signaling
  • platelet activation
  • regulation of sensory perception of pain
  • small molecule metabolic process
  • activation of MAPK activity by adrenergic receptor signaling pathway
  • activation of protein kinase B activity
  • adenylate cyclase-inhibiting adrenergic receptor signaling pathway
  • energy reserve metabolic process
  • epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway
  • G-protein coupled receptor signaling pathway
  • negative regulation of epinephrine secretion
  • regulation of insulin secretion
  • negative regulation of insulin secretion involved in cellular response to glucose stimulus
  • negative regulation of uterine smooth muscle contraction
  • negative regulation of norepinephrine secretion
  • female pregnancy
  • negative regulation of adenylate cyclase activity
  • blood coagulation
  • positive regulation of vasoconstriction
Components
  • plasma membrane
  • integral component of plasma membrane
  • axon terminus
  • endosome
  • cytoplasm
General FunctionProtein homodimerization activity
Specific FunctionAlpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Pfam Domain Function
Transmembrane Regions52-76 89-114 125-147 169-191 208-231 380-407 421-441
GenBank Protein ID178194
UniProtKB IDP18825
UniProtKB Entry NameADA2C_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010255|Alpha-2C adrenergic receptor (ADRA2C)
ATGGCGTCCCCGGCGCTGGCGGCGGCGCTGGCGGTGGCGGCAGCGGCGGGCCCCAATGCG
AGCGGCGCGGGCGAGAGGGGCAGCGGCGGGGTTGCCAATGCCTCGGGGGCTTCCTGGGGG
CCGCCGCGCGGCCAGTACTCGGCGGGCGCGGTGGCAGGGCTGGCTGCCGTGGTGGGCTTC
CTCATCGTCTTCACCGTGGTGGGCAACGTGCTGGTGGTGATCGCCGTGCTGACCAGCCGG
GCGCTGCGCGCGCCACAGAACCTCTTCCTGGTGTCGCTGGCCTCGGCCGACATCCTGGTG
GCCACGCTGGTCATGCCCTTCTCGTTGGCCAACGAGCTCATGGCCTACTGGTACTTCGGG
CAGGTGTGGTGCGGCGTGTACCTGGCGCTCGATGTGCTGTTTTGCACCTCGTCGATCGTG
CATCTGTGTGCCATCAGCCTGGACCGCTACTGGTCGGTGACGCAGGCCGTCGAGTACAAC
CTGAAGCGCACACCACGCCGCGTCAAGGCCACCATCGTGGCCGTGTGGCTCATCTCGGCC
GTCATCTCCTTCCCGCCGCTGGTCTCGCTCTACCGCCAGCCCGACGGCGCCGCCTACCCG
CAGTGCGGCCTCAACGACGAGACCTGGTACATCCTGTCCTCCTGCATCGGCTCCTTCTTC
GCGCCCTGCCTCATCATGGGCCTGGTCTACGCGCGCATCTACCGAGTGGCCAAGCTGCGC
ACGCGCACGCTCAGCGAGAAGCGCGCCCCCGTGGGCCCCGACGGTGCGTCCCCGACTACC
GAAAACGGGCTGGGCGCGGCGGCAGGCGCAGGCGAGAACGGGCACTGCGCGCCCCCGCCC
GCCGACGTGGAGCCGGACGAGAGCAGCGCAGCGGCCGAGAGGCGGCGGCGCCGGGGCGCG
TTGCGGCGGGGCGGGCGGCGGCGAGCGGGCGCGGAGGGGGGCGCGGGCGGTGCGGACGGG
CAGGGGGCGGGGCCGGGGGCGGCTGAGTCGGGGGCGCTGACCGCCTCCAGGTCCCCGGGG
CCCGGTGGCCGCCTGTCGCGCGCCAGCTCGCGCTCCGTCGAGTTCTTCCTGTCGCGCCGG
CGCCGGGCGCGCAGCAGCGTGTGCCGCCGCAAGGTGGCCCAGGCGCGCGAGAAGCGCTTC
ACCTTTGTGCTGGCTGTGGTCATGGGCGTGTTCGTGCTCTGCTGGTTCCCCTTCTTCTTC
AGCTACAGCCTGTACGGCATCTGCCGCGAGGCCTGCCAGGTGCCCGGCCCGCTCTTCAAG
TTCTTCTTCTGGATCGGCTACTGCAACAGCTCGCTCAACCCGGTCATCTACACGGTCTTC
AACCAGGATTTCCGGCGATCCTTTAAGCACATCCTCTTCCGACGGAGGAGAAGGGGCTTC
AGGCAGTGA
GenBank Gene IDJ03853
GeneCard IDNot Available
GenAtlas IDADRA2C
HGNC IDHGNC:283
Chromosome Location4
Locus4p16
References
  1. Regan JW, Kobilka TS, Yang-Feng TL, Caron MG, Lefkowitz RJ, Kobilka BK: Cloning and expression of a human kidney cDNA for an alpha 2-adrenergic receptor subtype. Proc Natl Acad Sci U S A. 1988 Sep;85(17):6301-5. 2842764
  2. Schaak S, Devedjian JC, Cayla C, Sender Y, Paris H: Molecular cloning, sequencing and functional study of the promoter region of the human alpha2C4-adrenergic receptor gene. Biochem J. 1997 Dec 1;328 ( Pt 2):431-8. 9371698
  3. Small KM, Forbes SL, Rahman FF, Bridges KM, Liggett SB: A four amino acid deletion polymorphism in the third intracellular loop of the human alpha 2C-adrenergic receptor confers impaired coupling to multiple effectors. J Biol Chem. 2000 Jul 28;275(30):23059-64. 10801795
  4. Small KM, Mialet-Perez J, Seman CA, Theiss CT, Brown KM, Liggett SB: Polymorphisms of cardiac presynaptic alpha2C adrenergic receptors: Diverse intragenic variability with haplotype-specific functional effects. Proc Natl Acad Sci U S A. 2004 Aug 31;101(35):13020-5. Epub 2004 Aug 19. 15319474
  5. Chhajlani V, Rangel N, Uhlen S, Wikberg JE: Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR. FEBS Lett. 1991 Mar 25;280(2):241-4. 1849485