Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NamePlasma membrane calcium-transporting ATPase 1
Synonyms
  • 3.6.3.8
  • Plasma membrane calcium ATPase isoform 1
  • Plasma membrane calcium pump isoform 1
  • PMCA1
Gene NameATP2B1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008750|Plasma membrane calcium-transporting ATPase 1
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGSSIQGALRRQPSI
ASQHHDVTNISTPTHIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRIEDSEPHIPLI
DDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL
Number of residues1258
Molecular Weight138754.045
Theoretical pINot Available
GO Classification
Functions
  • calcium-transporting ATPase activity
  • metal ion binding
  • PDZ domain binding
  • ATP binding
Processes
  • blood coagulation
  • cation transmembrane transport
  • transmembrane transport
  • transport
  • ion transmembrane transport
  • cellular calcium ion homeostasis
Components
  • nucleus
  • plasma membrane
  • extracellular exosome
  • integral component of plasma membrane
  • membrane
General FunctionPdz domain binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.
Pfam Domain Function
Transmembrane Regions98-118 155-175 367-386 420-437 853-872 883-903 924-946 965-986 1006-1027 1038-1059
GenBank Protein IDNot Available
UniProtKB IDP20020
UniProtKB Entry NameAT2B1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021417|Plasma membrane calcium-transporting ATPase 1 (ATP2B1)
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAA
GCTAATCATGATGGAGACTTTGGAATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTC
AGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGA
AGAGAAGCAGTGTTTGGAAAGAATTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAA
TTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTT
TCTGTTGGGGAGGAAGAAGGTGAAGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTC
TTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGT
CAGGTCATTCAGATACCTGTAGCTGACATTACTGTTGGAGATATTGCTCAAGTGAAATAT
GGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTT
CTATCAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTA
AATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGC
AACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAA
GGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATG
TCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAG
AAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACG
ATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTG
GATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTT
CCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTG
AATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTAT
CAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCT
GTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAG
GCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATG
GCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTG
GGGATTGAAGATCCTGTGAGACCTGAGGTGCCAGATGCAATTAAAAAGTGTCAGAGGGCT
GGAATTACTGTGCGGATGGTCACTGGTGATAATATTAATACTGCTCGGGCCATTGCTACC
AAATGTGGTATTTTACATCCTGGGGAAGATTTTCTGTGCCTAGAAGGTAAAGATTTTAAC
AGAAGAATACGAAATGAAAAAGGAGAGATTGAGCAAGAGAGGATAGACAAGATTTGGCCA
AAACTTCGAGTACTTGCAAGATCATCTCCTACTGATAAGCATACACTGGTTAAAGGTATA
ATTGACAGCACTGTCTCAGACCAACGCCAGGTTGTAGCTGTAACTGGTGATGGTACAAAT
GATGGCCCAGCACTAAAGAAAGCAGATGTTGGATTTGCAATGGGTATTGCTGGAACTGAT
GTAGCTAAAGAAGCATCCGATATTATTCTCACAGATGACAACTTTACAAGCATTGTTAAA
GCAGTTATGTGGGGACGAAATGTCTATGACAGCATCTCAAAATTCCTTCAGTTCCAACTT
ACTGTTAATGTAGTAGCAGTGATTGTTGCTTTTACGGGCGCCTGCATTACTCAAGACTCA
CCGCTTAAGGCTGTGCAGATGCTGTGGGTAAACCTCATAATGGATACACTCGCTTCCCTG
GCTCTGGCAACGGAACCACCCACTGAGTCTCTCTTGCTTCGGAAACCTTATGGTAGAAAT
AAGCCTCTCATCTCACGTACAATGATGAAGAATATTTTGGGTCATGCATTCTATCAACTT
GTAGTAGTCTTTACACTCTTATTTGCTGGAGAAAAGTTTTTTGACATTGATAGTGGAAGA
AATGCTCCTTTGCATGCTCCTCCTTCAGAACATTATACTATTGTTTTTAATACCTTTGTG
CTGATGCAACTTTTCAACGAAATAAATGCCCGGAAAATTCATGGTGAAAGAAATGTATTC
GAAGGAATCTTTAACAATGCCATCTTCTGCACAATTGTTTTAGGCACTTTTGTGGTACAG
ATAATAATTGTGCAGTTTGGTGGAAAACCTTTCAGTTGTTCAGAACTTTCAATAGAACAG
TGGCTATGGTCAATATTCCTAGGAATGGGAACATTACTCTGGGGCCAGCTTATTTCAACA
ATTCCAACTAGCCGTTTAAAATTCCTCAAAGAAGCTGGTCATGGAACACAAAAGGAAGAA
ATACCTGAGGAGGAATTAGCAGAGGATGTTGAAGAGATTGATCACGCTGAAAGGGAGTTG
CGGCGTGGCCAAATCTTGTGGTTTAGAGGTCTGAACAGAATCCAAACACAGATGGATGTA
GTGAATGCTTTCCAGAGTGGAAGTTCCATTCAGGGGGCTCTAAGGCGGCAACCCTCCATC
GCCAGCCAGCATCATGATGTAACAAATATTTCTACCCCTACACATGTAGTGTTTTCCTCT
TCTACTGCTTCTACTACTGTGGGGTATTCGAGTGGTGAATGCATTTCGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:814
Chromosome Location12
LocusNot Available
References
  1. Verma AK, Filoteo AG, Stanford DR, Wieben ED, Penniston JT, Strehler EE, Fischer R, Heim R, Vogel G, Mathews S, et al.: Complete primary structure of a human plasma membrane Ca2+ pump. J Biol Chem. 1988 Oct 5;263(28):14152-9. 2844759
  2. Kumar R, Haugen JD, Penniston JT: Molecular cloning of a plasma membrane calcium pump from human osteoblasts. J Bone Miner Res. 1993 Apr;8(4):505-13. 8386431
  3. Hilfiker H, Strehler-Page MA, Stauffer TP, Carafoli E, Strehler EE: Structure of the gene encoding the human plasma membrane calcium pump isoform 1. J Biol Chem. 1993 Sep 15;268(26):19717-25. 8396145
  4. Strehler EE, Strehler-Page MA, Vogel G, Carafoli E: mRNAs for plasma membrane calcium pump isoforms differing in their regulatory domain are generated by alternative splicing that involves two internal donor sites in a single exon. Proc Natl Acad Sci U S A. 1989 Sep;86(18):6908-12. 2528729
  5. Kessler F, Falchetto R, Heim R, Meili R, Vorherr T, Strehler EE, Carafoli E: Study of calmodulin binding to the alternatively spliced C-terminal domain of the plasma membrane Ca2+ pump. Biochemistry. 1992 Dec 1;31(47):11785-92. 1332771
  6. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1993 Dec 5;268(34):25993-6003. 8245032
  7. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1994 Dec 16;269(50):32022. 7989379
  8. Howard A, Legon S, Walters JR: Human and rat intestinal plasma membrane calcium pump isoforms. Am J Physiol. 1993 Nov;265(5 Pt 1):G917-25. 7694502
  9. James PH, Pruschy M, Vorherr TE, Penniston JT, Carafoli E: Primary structure of the cAMP-dependent phosphorylation site of the plasma membrane calcium pump. Biochemistry. 1989 May 16;28(10):4253-8. 2548572
  10. Wang KK, Wright LC, Machan CL, Allen BG, Conigrave AD, Roufogalis BD: Protein kinase C phosphorylates the carboxyl terminus of the plasma membrane Ca(2+)-ATPase from human erythrocytes. J Biol Chem. 1991 May 15;266(14):9078-85. 1827443
  11. Goellner GM, DeMarco SJ, Strehler EE: Characterization of PISP, a novel single-PDZ protein that binds to all plasma membrane Ca2+-ATPase b-splice variants. Ann N Y Acad Sci. 2003 Apr;986:461-71. 12763866
  12. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  13. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  14. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  15. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  16. Krapivinsky G, Krapivinsky L, Stotz SC, Manasian Y, Clapham DE: POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters. Proc Natl Acad Sci U S A. 2011 Nov 29;108(48):19234-9. doi: 10.1073/pnas.1117231108. Epub 2011 Nov 14. 22084111
  17. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  18. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  19. Benkwitz C, Kubisch C, Kraft K, Neyses L: Investigation of the Met-267 Arg exchange in isoform 1 of the human plasma membrane calcium pump in patients with essential hypertension by the amplification-created restriction site technique. J Mol Med (Berl). 1997 Jan;75(1):62-6. 9020386