| Name | Streptavidin |
|---|
| Synonyms | |
|---|
| Gene Name | Not Available |
|---|
| Organism | Streptomyces avidinii |
|---|
| Amino acid sequence | >lcl|BSEQ0011189|Streptavidin
MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGAD
GALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQY
VGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDA
VQQ |
|---|
| Number of residues | 183 |
|---|
| Molecular Weight | 18833.61 |
|---|
| Theoretical pI | 8.81 |
|---|
| GO Classification | |
|---|
| General Function | Not Available |
|---|
| Specific Function | The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | 46741 |
|---|
| UniProtKB ID | P22629 |
|---|
| UniProtKB Entry Name | SAV_STRAV |
|---|
| Cellular Location | Secreted |
|---|
| Gene sequence | >lcl|BSEQ0003308|552 bp
ATGCGCAAGATCGTCGTTGCAGCCATCGCCGTTTCCCTGACCACGGTCTCGATTACGGCC
AGCGCTTCGGCAGACCCCTCCAAGGACTCGAAGGCCCAGGTCTCGGCCGCCGAGGCCGGC
ATCACCGGCACCTGGTACAACCAGCTCGGCTCGACCTTCATCGTGACCGCGGGCGCCGAC
GGCGCCCTGACCGGAACCTACGAGTCGGCCGTCGGCAACGCCGAGAGCCGCTACGTCCTG
ACCGGTCGTTACGACAGCGCCCCGGCCACCGACGGCAGCGGCACCGCCCTCGGTTGGACG
GTGGCCTGGAAGAATAACTACCGCAACGCCCACTCCGCGACCACGTGGAGCGGCCAGTAC
GTCGGCGGCGCCGAGGCGAGGATCAACACCCAGTGGCTGCTGACCTCCGGCACCACCGAG
GCCAACGCCTGGAAGTCCACGCTGGTCGGCCACGACACCTTCACCAAGGTGAAGCCGTCC
GCCGCCTCCATCGACGCGGCGAAGAAGGCCGGCGTCAACAACGGCAACCCGCTCGACGCC
GTTCAGCAGTAG |
|---|
| GenBank Gene ID | X03591 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Argarana CE, Kuntz ID, Birken S, Axel R, Cantor CR: Molecular cloning and nucleotide sequence of the streptavidin gene. Nucleic Acids Res. 1986 Feb 25;14(4):1871-82. 3951999
- Gitlin G, Bayer EA, Wilchek M: Studies on the biotin-binding site of streptavidin. Tryptophan residues involved in the active site. Biochem J. 1988 Nov 15;256(1):279-82. 3223904
- Gitlin G, Bayer EA, Wilchek M: Studies on the biotin-binding sites of avidin and streptavidin. Tyrosine residues are involved in the binding site. Biochem J. 1990 Jul 15;269(2):527-30. 2386489
- Alon R, Bayer EA, Wilchek M: Streptavidin contains an RYD sequence which mimics the RGD receptor domain of fibronectin. Biochem Biophys Res Commun. 1990 Aug 16;170(3):1236-41. 2390089
- Weber PC, Ohlendorf DH, Wendoloski JJ, Salemme FR: Structural origins of high-affinity biotin binding to streptavidin. Science. 1989 Jan 6;243(4887):85-8. 2911722
- Freitag S, Le Trong I, Klumb L, Stayton PS, Stenkamp RE: Structural studies of the streptavidin binding loop. Protein Sci. 1997 Jun;6(6):1157-66. 9194176
- Katz BA, Cass RT: In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0. J Biol Chem. 1997 May 16;272(20):13220-8. 9148939
- Katz BA: Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH. J Mol Biol. 1997 Dec 19;274(5):776-800. 9405158
- Freitag S, Le Trong I, Chilkoti A, Klumb LA, Stayton PS, Stenkamp RE: Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex. J Mol Biol. 1998 May 29;279(1):211-21. 9636711
|
|---|