| Name | Chorismate pyruvate-lyase |
|---|
| Synonyms | |
|---|
| Gene Name | ubiC |
|---|
| Organism | Escherichia coli (strain K12) |
|---|
| Amino acid sequence | >lcl|BSEQ0002992|Chorismate pyruvate-lyase
MSHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNE
IPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLF
TSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY |
|---|
| Number of residues | 165 |
|---|
| Molecular Weight | 18776.68 |
|---|
| Theoretical pI | 8.2 |
|---|
| GO Classification | Functions - chorismate lyase activity
Processes - pyruvate biosynthetic process
- ubiquinone biosynthetic process
Components |
|---|
| General Function | Chorismate lyase activity |
|---|
| Specific Function | Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4-hydroxybenzoate (4HB) for the ubiquinone pathway. |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | 43231 |
|---|
| UniProtKB ID | P26602 |
|---|
| UniProtKB Entry Name | UBIC_ECOLI |
|---|
| Cellular Location | Cytoplasm |
|---|
| Gene sequence | >lcl|BSEQ0021294|Chorismate pyruvate-lyase (ubiC)
ATGTCACACCCCGCGTTAACGCAACTGCGTGCGCTGCGCTATTGTAAAGAGATCCCTGCC
CTGGATCCGCAACTGCTCGACTGGCTGTTGCTGGAGGATTCCATGACAAAACGTTTTGAA
CAGCAGGGAAAAACGGTAAGCGTGACGATGATCCGCGAAGGGTTTGTCGAGCAGAATGAA
ATCCCCGAAGAACTGCCGCTGCTGCCGAAAGAGTCTCGTTACTGGTTACGTGAAATTTTG
TTATGTGCCGATGGTGAACCGTGGCTTGCCGGTCGTACCGTCGTTCCTGTGTCAACGTTA
AGCGGGCCGGAGCTGGCGTTACAAAAATTGGGTAAAACGCCGTTAGGACGCTATCTGTTC
ACATCATCGACATTAACCCGGGACTTTATTGAGATAGGCCGTGATGCCGGGCTGTGGGGG
CGACGTTCCCGCCTGCGATTAAGCGGTAAACCGCTGTTGCTAACAGAACTGTTTTTACCG
GCGTCACCGTTGTACTAA |
|---|
| GenBank Gene ID | X66619 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Siebert M, Bechthold A, Melzer M, May U, Berger U, Schroder G, Schroder J, Severin K, Heide L: Ubiquinone biosynthesis. Cloning of the genes coding for chorismate pyruvate-lyase and 4-hydroxybenzoate octaprenyl transferase from Escherichia coli. FEBS Lett. 1992 Aug 3;307(3):347-50. 1644192
- Nichols BP, Green JM: Cloning and sequencing of Escherichia coli ubiC and purification of chorismate lyase. J Bacteriol. 1992 Aug;174(16):5309-16. 1644758
- Nishimura K, Nakahigashi K, Inokuchi H: Location of the ubiA gene on the physical map of Escherichia coli. J Bacteriol. 1992 Sep;174(17):5762. 1512213
- Wu G, Williams HD, Gibson F, Poole RK: Mutants of Escherichia coli affected in respiration: the cloning and nucleotide sequence of ubiA, encoding the membrane-bound p-hydroxybenzoate:octaprenyltransferase. J Gen Microbiol. 1993 Aug;139(8):1795-805. 8409922
- Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL: Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Nucleic Acids Res. 1993 Nov 25;21(23):5408-17. 8265357
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. 9278503
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. 16738553
- Siebert M, Severin K, Heide L: Formation of 4-hydroxybenzoate in Escherichia coli: characterization of the ubiC gene and its encoded enzyme chorismate pyruvate-lyase. Microbiology. 1994 Apr;140 ( Pt 4):897-904. 8012607
- Holden MJ, Mayhew MP, Gallagher DT, Vilker VL: Chorismate lyase: kinetics and engineering for stability. Biochim Biophys Acta. 2002 Jan 31;1594(1):160-7. 11825618
- Stover C, Mayhew MP, Holden MJ, Howard A, Gallagher DT: Crystallization and 1.1-A diffraction of chorismate lyase from Escherichia coli. J Struct Biol. 2000 Feb;129(1):96-9. 10675300
- Gallagher DT, Mayhew M, Holden MJ, Howard A, Kim KJ, Vilker VL: The crystal structure of chorismate lyase shows a new fold and a tightly retained product. Proteins. 2001 Aug 15;44(3):304-11. 11455603
- Smith N, Roitberg AE, Rivera E, Howard A, Holden MJ, Mayhew M, Kaistha S, Gallagher DT: Structural analysis of ligand binding and catalysis in chorismate lyase. Arch Biochem Biophys. 2006 Jan 1;445(1):72-80. Epub 2005 Nov 22. 16343413
|
|---|