You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase mu
Synonyms
  • 3.1.3.48
  • Protein-tyrosine phosphatase mu
  • PTPRL1
Gene NamePTPRM
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009011|Receptor-type tyrosine-protein phosphatase mu
MRGLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDED
LPGAVPTESIQGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DNTVTVMLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRIYFQAASRANGETKIDCVQVA
TKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSST
RQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYID
GYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYK
DIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQV
KSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQT
EEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL
RVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLE
EDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNG
GEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKF
CYEVALEYLNSG
Number of residues1452
Molecular Weight163681.285
Theoretical pINot Available
GO Classification
Functions
  • cadherin binding
  • protein tyrosine phosphatase activity
  • transmembrane receptor protein tyrosine phosphatase activity
  • identical protein binding
Processes
  • peptidyl-tyrosine dephosphorylation
  • signal transduction
  • response to drug
  • negative regulation of angiogenesis
  • retina layer formation
  • retinal ganglion cell axon guidance
  • neuron projection development
  • protein dephosphorylation
  • homophilic cell adhesion via plasma membrane adhesion molecules
  • positive regulation of vasodilation
  • negative regulation of endothelial cell migration
  • negative regulation of endothelial cell proliferation
Components
  • cell-cell adherens junction
  • lamellipodium
  • cytoplasm
  • perinuclear region of cytoplasm
  • integral component of plasma membrane
  • cell-cell junction
General FunctionTransmembrane receptor protein tyrosine phosphatase activity
Specific FunctionInvolved in cell-cell adhesion through homophilic interactions. May play a key role in signal transduction and growth control.
Pfam Domain Function
Transmembrane Regions743-764
GenBank Protein IDNot Available
UniProtKB IDP28827
UniProtKB Entry NamePTPRM_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013562|Receptor-type tyrosine-protein phosphatase mu (PTPRM)
ATGAGGGGACTTGGGACTTGCCTGGCGACTTTGGCCGGACTTTTGCTAACTGCGGCGGGC
GAGACGTTCTCAGGTGGCTGCCTCTTTGATGAGCCGTATAGCACATGTGGATATAGTCAA
TCTGAAGGTGATGACTTCAATTGGGAGCAAGTGAACACCTTGACTAAACCGACTTCTGAT
CCATGGATGCCATCAGGTTCTTTCATGCTGGTGAATGCCTCTGGGAGACCTGAGGGGCAG
AGAGCCCACCTGCTCTTACCCCAACTTAAAGAAAATGACACCCACTGCATCGATTTTCAC
TATTTTGTGTCCAGCAAGAGTAATTCTCCTCCGGGGTTACTCAATGTCTACGTGAAGGTC
AATAACGGGCCACTGGGGAATCCTATCTGGAATATATCTGGAGACCCAACACGTACATGG
AACAGGGCAGAACTGGCCATTAGTACTTTCTGGCCTAACTTTTATCAGGTGATTTTTGAA
GTGATAACTTCTGGACATCAAGGCTATCTCGCTATCGATGAGGTGAAGGTGTTAGGACAT
CCATGTACCAGGACTCCTCACTTCCTGCGGATTCAGAATGTGGAAGTTAATGCTGGCCAG
TTTGCTACCTTCCAGTGCAGTGCCATCGGCAGGACCGTGGCAGGAGACAGGCTCTGGTTA
CAGGGCATTGATGTGCGAGATGCTCCTCTGAAGGAAATCAAGGTGACCAGCTCCCGACGC
TTCATTGCTTCATTTAATGTTGTGAATACCACCAAACGAGATGCTGGAAAGTACCGCTGC
ATGATTCGCACTGAAGGAGGTGTTGGAATATCAAACTATGCAGAGTTGGTAGTTAAAGAA
CCACCCGTTCCTATTGCCCCACCTCAGCTCGCCTCTGTAGGAGCCACCTACCTGTGGATA
CAGCTCAACGCCAACTCCATCAATGGGGATGGGCCCATTGTGGCCCGAGAGGTGGAGTAC
TGCACGGCCAGTGGGAGCTGGAATGACCGGCAGCCAGTCGATTCCACGAGCTATAAAATT
GGACACCTTGACCCAGATACAGAATATGAGATTAGTGTGCTCCTGACCAGGCCAGGGGAG
GGTGGCACTGGCTCTCCTGGTCCAGCTCTCAGGACAAGAACAAAGTGTGCTGATCCCATG
CGAGGCCCAAGAAAACTAGAAGTAGTGGAGGTCAAATCTCGGCAAATCACTATCCGCTGG
GAGCCATTTGGATATAATGTAACTCGTTGCCACAGTTATAATCTCACTGTCCACTACTGT
TACCAAGTTGGAGGACAAGAACAAGTGCGAGAAGAAGTAAGCTGGGATACAGAAAACTCA
CACCCTCAACACACGATCACTAACCTGTCACCATACACCAATGTCAGTGTGAAACTGATC
CTCATGAACCCAGAGGGCCGGAAGGAAAGCCAAGAACTCATAGTGCAGACAGATGAAGAC
CTCCCAGGTGCTGTTCCCACTGAATCCATACAAGGAAGTACCTTTGAAGAGAAGATATTT
CTTCAGTGGAGAGAACCAACTCAAACATATGGTGTAATCACTTTATATGAGATCACCTAC
AAAGCAGTCAGTTCCTTTGACCCAGAAATAGATTTATCCAATCAGAGTGGAAGAGTTTCA
AAGCTGGGAAATGAAACCCATTTTCTGTTTTTTGGACTGTATCCGGGGACCACATACTCC
TTTACCATCCGAGCTAGCACAGCTAAGGGTTTTGGGCCTCCAGCAACAAACCAGTTCACC
ACCAAAATATCAGCACCCTCTATGCCAGCTTATGAACTTGAGACACCTTTGAATCAAACT
GACAATACCGTGACAGTCATGCTGAAACCTGCCCACAGCAGAGGAGCACCTGTCAGTGTC
TATCAAATAGTTGTTGAGGAAGAACGTCCTCGAAGAACTAAAAAGACGACAGAAATCTTA
AAGTGCTACCCAGTGCCAATTCACTTCCAGAATGCTTCTCTGCTGAACTCACAGTACTAC
TTTGCTGCAGAATTTCCTGCAGACAGCCTCCAAGCTGCGCAGCCTTTTACAATTGGTGAT
AATAAGACATATAATGGATACTGGAACACTCCCCTTCTCCCCTATAAAAGCTACAGAATT
TATTTCCAAGCTGCTAGTAGAGCCAATGGGGAAACCAAAATAGACTGTGTCCAAGTGGCC
ACAAAAGGAGCTGCCACTCCGAAACCAGTCCCAGAACCCGAGAAACAGACAGACCATACA
GTTAAAATTGCTGGAGTCATCGCGGGCATCTTGCTGTTCGTGATTATATTTCTTGGAGTT
GTGTTGGTAATGAAGAAAAGGAAACTGGCCAAGAAGCGGAAAGAGACCATGAGCAGCACC
CGACAGGAGATGACTGTGATGGTGAACTCAATGGACAAGAGCTATGCTGAGCAGGGCACA
AACTGCGACGAGGCTTTCTCATTCATGGACACGCACAATCTGAATGGGAGATCTGTGTCT
TCACCATCGTCCTTCACAATGAAAACAAATACACTGAGCACATCGGTGCCTAATTCCTAT
TACCCAGACCCATTTGTGCCAACTGCAATTTTAGTGCCAATAAATGATGAAACCCACACA
ATGGCCAGCGATACCAGCAGCCTGGTGCAGTCCCATACTTACAAGAAGCGAGAGCCGGCC
GACGTGCCCTATCAGACTGGGCAGCTCCACCCCGCCATCCGGGTGGCAGACCTCCTTCAG
CACATCACACAGATGAAGTGTGCGGAGGGCTACGGCTTCAAGGAGGAATACGAGAGCTTC
TTTGAAGGGCAGTCTGCACCATGGGACTCGGCTAAGAAAGATGAGAACAGAATGAAGAAC
AGATACGGGAATATCATTGCATACGATCATTCCCGAGTGAGGCTGCAGACAATAGAAGGA
GACACAAACTCAGACTATATCAATGGCAATTATATCGATGGTTATCATCGACCCAATCAT
TACATTGCTACCCAAGGGCCAATGCAGGAAACCATCTATGACTTCTGGAGGATGGTGTGG
CACGAAAACACTGCAAGTATCATCATGGTGACCAATCTTGTGGAAGTGGGAAGGGTCAAA
TGCTGCAAATACTGGCCAGATGACACAGAGATATATAAAGACATTAAAGTTACCCTAATA
GAAACAGAACTACTGGCAGAATATGTGATAAGAACATTTGCTGTTGAAAAGAGAGGTGTG
CATGAAATCCGAGAGATCAGACAGTTTCACTTCACTGGCTGGCCGGATCATGGGGTCCCC
TACCATGCCACCGGCCTGCTGGGATTCGTGCGGCAAGTCAAGTCCAAGAGCCCGCCCAGT
GCAGGCCCACTGGTGGTGCACTGCAGTGCTGGTGCAGGGAGGACTGGCTGTTTCATCGTC
ATTGATATCATGTTGGACATGGCCGAAAGGGAAGGGGTCGTAGACATCTACAACTGCGTC
AGGGAGCTGCGGTCACGGAGGGTGAACATGGTGCAAACAGAGGAGCAGTATGTGTTTATC
CACGATGCGATCCTGGAAGCCTGTCTTTGTGGGGACACCTCTGTGCCTGCTTCCCAAGTT
AGGTCTCTGTATTATGACATGAACAAACTGGATCCACAGACAAACTCAAGCCAGATTAAA
GAGGAATTCCGGACGCTAAACATGGTGACACCAACGCTGCGAGTAGAGGACTGCAGCATC
GCACTGTTGCCCCGGAACCATGAGAAAAACCGGTGCATGGACATCCTGCCCCCAGACCGC
TGCCTGCCCTTCCTCATCACCATCGATGGGGAGAGCAGCAACTACATCAATGCTGCCCTC
ATGGACAGCTATAAACAGCCTTCAGCTTTTATAGTCACCCAGCATCCTTTGCCAAACACA
GTGAAAGACTTTTGGAGACTGGTCCTGGATTATCACTGCACATCCGTAGTTATGCTAAAT
GATGTGGATCCTGCCCAGTTGTGTCCACAGTACTGGCCAGAAAACGGAGTACACAGACAC
GGCCCCATCCAGGTGGAATTTGTCTCTGCTGACCTGGAAGAGGACATCATCAGCAGGATA
TTCCGCATTTACAATGCCGCCAGACCCCAAGATGGATATCGGATGGTGCAGCAATTCCAG
TTCCTGGGCTGGCCGATGTACAGGGACACACCAGTGTCTAAGCGCTCCTTCTTGAAGCTC
ATTCGCCAGGTGGACAAGTGGCAAGAGGAGTACAATGGCGGGGAAGGCCGCACGGTTGTG
CACTGCTTGAACGGGGGAGGCCGCAGTGGGACGTTCTGCGCCATCAGCATCGTATGTGAG
ATGCTCCGGCACCAGAGAACCGTGGATGTCTTTCACGCTGTGAAGACACTGAGGAACAAC
AAGCCCAACATGGTCGACCTCCTGGATCAGTACAAGTTCTGCTACGAGGTGGCCCTGGAA
TACTTGAATTCTGGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9675
Chromosome Location18
LocusNot Available
References
  1. Gebbink MF, van Etten I, Hateboer G, Suijkerbuijk R, Beijersbergen RL, Geurts van Kessel A, Moolenaar WH: Cloning, expression and chromosomal localization of a new putative receptor-like protein tyrosine phosphatase. FEBS Lett. 1991 Sep 23;290(1-2):123-30. 1655529
  2. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. 16177791
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  6. Hoffmann KM, Tonks NK, Barford D: The crystal structure of domain 1 of receptor protein-tyrosine phosphatase mu. J Biol Chem. 1997 Oct 31;272(44):27505-8. 9346878
  7. Aricescu AR, Hon WC, Siebold C, Lu W, van der Merwe PA, Jones EY: Molecular analysis of receptor protein tyrosine phosphatase mu-mediated cell adhesion. EMBO J. 2006 Feb 22;25(4):701-12. Epub 2006 Feb 2. 16456543