You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit alpha-5
Synonyms
  • NACHRA5
Gene NameCHRNA5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017148|Neuronal acetylcholine receptor subunit alpha-5
MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK
Number of residues468
Molecular Weight53053.965
Theoretical pI6.98
GO Classification
Functions
  • ligand-gated ion channel activity
  • acetylcholine-activated cation-selective channel activity
  • acetylcholine receptor activity
  • acetylcholine binding
Processes
  • cation transmembrane transport
  • transport
  • neurological system process
  • signal transduction
  • behavioral response to nicotine
  • synaptic transmission
  • ion transmembrane transport
  • synaptic transmission, cholinergic
  • neuromuscular synaptic transmission
  • regulation of membrane potential
Components
  • acetylcholine-gated channel complex
  • postsynaptic membrane
  • plasma membrane
  • cell junction
  • dendrite
  • synapse
  • neuron projection
  • neuronal cell body
General FunctionLigand-gated ion channel activity
Specific FunctionAfter binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Pfam Domain Function
Transmembrane Regions255-275 282-302 317-337 430-451
GenBank Protein ID177926
UniProtKB IDP30532
UniProtKB Entry NameACHA5_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0017149|Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)
ATGGCGGCGCGGGGGTCAGGGCCCCGCGCGCTCCGCCTGCTGCTCTTGGTCCAGCTGGTC
GCGGGGCGCTGCGGTCTAGCGGGCGCGGCGGGCGGCGCGCAGAGAGGATTATCTGAACCT
TCTTCTATTGCAAAACATGAAGATAGTTTGCTTAAGGATTTATTTCAAGACTACGAAAGA
TGGGTTCGTCCTGTGGAACACCTGAATGACAAAATAAAAATAAAATTTGGACTTGCAATA
TCTCAATTGGTGGATGTGGATGAGAAAAATCAGTTAATGACAACAAACGTCTGGTTGAAA
CAGGAATGGATAGATGTAAAATTAAGATGGAACCCTGATGACTATGGTGGAATAAAAGTT
ATACGTGTTCCTTCAGACTCTGTCTGGACACCAGACATCGTTTTGTTTGATAATGCAGAT
GGACGTTTTGAAGGGACCAGTACGAAAACAGTCATCAGGTACAATGGCACTGTCACCTGG
ACTCCACCGGCAAACTACAAAAGTTCCTGTACCATAGATGTCACGTTTTTCCCATTTGAC
CTTCAGAACTGTTCCATGAAATTTGGTTCTTGGACTTATGATGGATCACAGGTTGATATA
ATTCTAGAGGACCAAGATGTAGACAAGAGAGATTTTTTTGATAATGGAGAATGGGAGATT
GTGAGTGCAACAGGGAGCAAAGGAAACAGAACCGACAGCTGTTGCTGGTATCCGTATGTC
ACTTACTCATTTGTAATCAAGCGCCTGCCTCTCTTTTATACCTTGTTCCTTATAATACCC
TGTATTGGGCTCTCATTTTTAACTGTACTTGTCTTCTATCTTCCTTCAAATGAAGGTGAA
AAGATTTGTCTCTGCACTTCAGTACTTGTGTCTTTGACTGTCTTCCTTCTGGTTATTGAA
GAGATCATACCATCATCTTCAAAAGTCATACCTCTAATTGGAGAGTATCTGGTATTTACC
ATGATTTTTGTGACACTGTCAATTATGGTAACCGTCTTCGCTATCAACATTCATCATCGT
TCTTCCTCAACACATAATGCCATGGCGCCTTTGGTCCGCAAGATATTTCTTCACACGCTT
CCCAAACTGCTTTGCATGAGAAGTCATGTAGACAGGTACTTCACTCAGAAAGAGGAAACT
GAGAGTGGTAGTGGACCAAAATCTTCTAGAAACACATTGGAAGCTGCGCTCGATTCTATT
CGCTACATTACAAGACACATCATGAAGGAAAATGATGTCCGTGAGGTTGTTGAAGATTGG
AAATTCATAGCCCAGGTTCTTGATCGGATGTTTCTGTGGACTTTTCTTTTCGTTTCAATT
GTTGGATCTCTTGGGCTTTTTGTTCCTGTTATTTATAAATGGGCAAATATATTAATACCA
GTTCATATTGGAAATGCAAATAAGTGA
GenBank Gene IDM83712
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1959
Chromosome Location15
Locus15q24
References
  1. Chini B, Clementi F, Hukovic N, Sher E: Neuronal-type alpha-bungarotoxin receptors and the alpha 5-nicotinic receptor subunit gene are expressed in neuronal and nonneuronal human cell lines. Proc Natl Acad Sci U S A. 1992 Mar 1;89(5):1572-6. 1542648
  2. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. 8906617
  3. Groot Kormelink PJ, Luyten WH: Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 1997 Jan 6;400(3):309-14. 9009220
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Chanock SJ, Hunter DJ: Genomics: when the smoke clears ... Nature. 2008 Apr 3;452(7187):537-8. doi: 10.1038/452537a. 18385720
  6. Hung RJ, McKay JD, Gaborieau V, Boffetta P, Hashibe M, Zaridze D, Mukeria A, Szeszenia-Dabrowska N, Lissowska J, Rudnai P, Fabianova E, Mates D, Bencko V, Foretova L, Janout V, Chen C, Goodman G, Field JK, Liloglou T, Xinarianos G, Cassidy A, McLaughlin J, Liu G, Narod S, Krokan HE, Skorpen F, Elvestad MB, Hveem K, Vatten L, Linseisen J, Clavel-Chapelon F, Vineis P, Bueno-de-Mesquita HB, Lund E, Martinez C, Bingham S, Rasmuson T, Hainaut P, Riboli E, Ahrens W, Benhamou S, Lagiou P, Trichopoulos D, Holcatova I, Merletti F, Kjaerheim K, Agudo A, Macfarlane G, Talamini R, Simonato L, Lowry R, Conway DI, Znaor A, Healy C, Zelenika D, Boland A, Delepine M, Foglio M, Lechner D, Matsuda F, Blanche H, Gut I, Heath S, Lathrop M, Brennan P: A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25. Nature. 2008 Apr 3;452(7187):633-7. doi: 10.1038/nature06885. 18385738
  7. Amos CI, Wu X, Broderick P, Gorlov IP, Gu J, Eisen T, Dong Q, Zhang Q, Gu X, Vijayakrishnan J, Sullivan K, Matakidou A, Wang Y, Mills G, Doheny K, Tsai YY, Chen WV, Shete S, Spitz MR, Houlston RS: Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1. Nat Genet. 2008 May;40(5):616-22. doi: 10.1038/ng.109. Epub 2008 Apr 2. 18385676