You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHigh affinity cationic amino acid transporter 1
Synonyms
  • ATRC1
  • CAT-1
  • Ecotropic retroviral leukemia receptor homolog
  • Ecotropic retrovirus receptor homolog
  • ERR
  • REC1L
  • Solute carrier family 7 member 1
  • System Y+ basic amino acid transporter
Gene NameSLC7A1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010202|High affinity cationic amino acid transporter 1
MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARE
NAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILS
YIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLT
LGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEG
KPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA
YFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPR
VIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAY
SLVAACVLVLRYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTI
LSPKNMEPSKISGLIVNISTSLIAVLIITFCIVTVLGREALTKGALWAVFLLAGSALLCA
VVTGVIWRQPESKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIY
FGYGLWHSEEASLDADQARTPDGNLDQCK
Number of residues629
Molecular Weight67637.62
Theoretical pI5.06
GO Classification
Functions
  • antiporter activity
  • arginine transmembrane transporter activity
  • L-lysine transmembrane transporter activity
  • L-ornithine transmembrane transporter activity
Processes
  • transport
  • ion transport
  • amino acid transport
  • transmembrane transport
  • L-arginine import across plasma membrane
  • L-lysine transmembrane transport
  • L-ornithine transmembrane transport
Components
  • membrane
  • plasma membrane
  • integral component of plasma membrane
General FunctionL-ornithine transmembrane transporter activity
Specific FunctionHigh-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor.
Pfam Domain Function
Transmembrane Regions36-57 62-82 103-123 163-183 192-212 247-267 288-307 338-358 385-405 409-429 493-513 527-551 560-580 585-605
GenBank Protein ID36161
UniProtKB IDP30825
UniProtKB Entry NameCTR1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010203|High affinity cationic amino acid transporter 1 (SLC7A1)
ATGGGGTGCAAAGTCCTGCTCAACATTGGGCAGCAGATGCTGCGGCGGAAGGTGGTGGAC
TGTAGCCGGGAGGAGACGCGGCTGTCTCGCTGCCTGAACACTTTTGATCTGGTGGCCCTC
GGGGTGGGCAGCACACTGGGTGCTGGTGTCTACGTCCTGGCTGGAGCTGTGGCCCGTGAG
AATGCAGGCCCTGCCATTGTCATCTCCTTCCTGATCGCTGCGCTGGCCTCAGTGCTGGCT
GGCCTGTGCTATGGCGAGTTTGGTGCTCGGGTCCCCAAGACGGGCTCAGCTTACCTCTAC
AGCTATGTCACCGTTGGAGAGCTCTGGGCCTTCATCACCGGCTGGAACTTAATCCTCTCC
TACATCATCGGTACTTCAAGCGTAGCGAGGGCCTGGAGCGCCACCTTCGACGAGCTGATA
GGCAGACCCATCGGGGAGTTCTCACGGACACACATGACTCTGAACGCCCCCGGCGTGCTG
GCTGAAAACCCCGACATATTCGCAGTGATCATAATTCTCATCTTGACAGGACTTTTAACT
CTTGGTGTGAAAGAGTCGGCCATGGTCAACAAAATATTCACTTGTATTAACGTCCTGGTC
CTGGGCTTCATAATGGTGTCAGGATTTGTGAAAGGATCGGTTAAAAACTGGCAGCTCACG
GAGGAGGATTTTGGGAACACATCAGGCCGTCTCTGTTTGAACAATGACACAAAAGAAGGG
AAGCCCGGTGTTGGTGGATTCATGCCCTTCGGGTTCTCTGGTGTCCTGTCGGGGGCAGCG
ACTTGCTTCTATGCCTTCGTGGGCTTTGACTGCATCGCCACCACAGGTGAAGAGGTGAAG
AACCCACAGAAGGCCATCCCCGTGGGGATCGTGGCGTCCCTCTTGATCTGCTTCATCGCC
TACTTTGGGGTGTCGGCTGCCCTCACGCTCATGATGCCCTACTTCTGCCTGGACAATAAC
AGCCCCCTGCCCGACGCCTTTAAGCACGTGGGCTGGGAAGGTGCCAAGTACGCAGTGGCC
GTGGGCTCCCTCTGCGCTCTTTCCGCCAGTCTTCTAGGTTCCATGTTTCCCATGCCTCGG
GTTATCTATGCCATGGCTGAGGATGGACTGCTATTTAAATTCTTAGCCAACGTCAATGAT
AGGACCAAAACACCAATAATCGCCACATTAGCCTCGGGTGCCGTTGCTGCTGTGATGGCC
TTCCTCTTTGACCTGAAGGACTTGGTGGACCTCATGTCCATTGGCACTCTCCTGGCTTAC
TCGTTGGTGGCTGCCTGTGTGTTGGTCTTACGGTACCAGCCAGAGCAGCCTAACCTGGTA
TACCAGATGGCCAGTACTTCCGACGAGTTAGATCCAGCAGACCAAAATGAATTGGCAAGC
ACCAATGATTCCCAGCTGGGGTTTTTACCAGAGGCAGAGATGTTCTCTTTGAAAACCATA
CTCTCACCCAAAAACATGGAGCCTTCCAAAATCTCTGGGCTAATTGTGAACATTTCAACC
AGCCTTATAGCTGTTCTCATCATCACCTTCTGCATTGTGACCGTGCTTGGAAGGGAGGCT
CTCACCAAAGGGGCGCTGTGGGCAGTCTTTCTGCTCGCAGGGTCTGCCCTCCTCTGTGCC
GTGGTCACGGGCGTCATCTGGAGGCAGCCCGAGAGCAAGACCAAGCTCTCATTTAAGGTT
CCCTTCCTGCCAGTGCTCCCCATCCTGAGCATCTTCGTGAACGTCTATCTCATGATGCAG
CTGGACCAGGGCACCTGGGTCCGGTTTGCTGTGTGGATGCTGATAGGCTTCATCATCTAC
TTTGGCTATGGCCTGTGGCACAGCGAGGAGGCGTCCCTGGATGCCGACCAAGCAAGGACT
CCTGACGGCAACTTGGACCAGTGCAAGTGA
GenBank Gene IDX59155
GeneCard IDNot Available
GenAtlas IDSLC7A1
HGNC IDHGNC:11057
Chromosome Location13
Locus13q12-q14
References
  1. Yoshimoto T, Yoshimoto E, Meruelo D: Molecular cloning and characterization of a novel human gene homologous to the murine ecotropic retroviral receptor. Virology. 1991 Nov;185(1):10-7. 1718082
  2. Albritton LM, Bowcock AM, Eddy RL, Morton CC, Tseng L, Farrer LA, Cavalli-Sforza LL, Shows TB, Cunningham JM: The human cationic amino acid transporter (ATRC1): physical and genetic mapping to 13q12-q14. Genomics. 1992 Mar;12(3):430-4. 1348489
  3. Kamath SG, Furesz TC, Way BA, Smith CH: Identification of three cationic amino acid transporters in placental trophoblast: cloning, expression, and characterization of hCAT-1. J Membr Biol. 1999 Sep 1;171(1):55-62. 10485994
  4. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. 15057823
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. 19349973