You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNeuronal acetylcholine receptor subunit alpha-3
Synonyms
  • NACHRA3
Gene NameCHRNA3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006903|Neuronal acetylcholine receptor subunit alpha-3
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
Number of residues505
Molecular Weight57479.54
Theoretical pI6.4
GO Classification
Functions
  • acetylcholine-activated cation-selective channel activity
  • acetylcholine binding
  • acetylcholine receptor activity
  • drug binding
  • ligand-gated ion channel activity
Processes
  • regulation of smooth muscle contraction
  • nervous system development
  • synaptic transmission, cholinergic
  • behavioral response to nicotine
  • regulation of dendrite morphogenesis
  • locomotory behavior
  • ion transport
  • synaptic transmission involved in micturition
  • signal transduction
  • response to inorganic substance
  • response to drug
  • protein heterooligomerization
  • activation of transmembrane receptor protein tyrosine kinase activity
  • synaptic transmission
  • regulation of membrane potential
  • excitatory postsynaptic potential
  • cation transmembrane transport
  • heart development
  • neurological system process
  • ion transmembrane transport
  • regulation of acetylcholine secretion, neurotransmission
Components
  • dendrite
  • acetylcholine-gated channel complex
  • synapse
  • neuron projection
  • postsynaptic density
  • postsynaptic membrane
  • neuronal cell body
  • plasma membrane
  • cell junction
  • integral component of membrane
General FunctionLigand-gated ion channel activity
Specific FunctionAfter binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Pfam Domain Function
Transmembrane Regions241-265 273-291 307-328 478-497
GenBank Protein ID177898
UniProtKB IDP32297
UniProtKB Entry NameACHA3_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0012491|Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3)
ATGGGCTCTGGCCCGCTCTCGCTGCCCCTGGCGCTGTCGCCGCCGCGGCTGCTGCTGCTG
CTGCTGCTGTCTCTGCTGCCAGTGGCCAGGGCCTCAGAGGCTGAGCACCGTCTATTTGAG
CGGCTGTTTGAAGATTACAATGAGATCATCCGGCCTGTAGCCAACGTGTCTGACCCAGTC
ATCATCCATTTCGAGGTGTCCATGTCTCAGCTGGTGAAGGTGGATGAAGTAAACCAGATC
ATGGAGACCAACCTGTGGCTCAAGCAAATCTGGAATGACTACAAGCTGAAATGGAACCCC
TCTGACTATGGTGGGGCAGAGTTCATGCGTGTCCCTGCACAGAAGATCTGGAAGCCAGAC
ATTGTGCTGTATAACAATGCTGTTGGGGATTTCCAGGTGGACGACAAGACCAAAGCCTTA
CTCAAGTACACTGGGGAGGTGACTTGGATACCTCCGGCCATCTTTAAGAGCTCCTGTAAA
ATCGACGTGACCTACTTCCCGTTTGATTACCAAAACTGTACCATGAAGTTCGGTTCCTGG
TCCTACGATAAGGCGAAAATCGATCTGGTCCTGATCGGCTCTTCCATGAACCTCAAGGAC
TATTGGGAGAGCGGCGAGTGGGCCATCATCAAAGCCCCAGGCTACAAACACGACATCAAG
TACAACTGCTGCGAGGAGATCTACCCCGACATCACATACTCGCTGTACATCCGGCGCCTG
CCCTTGTTCTACACCATCAACCTCATCATCCCCTGCCTGCTCATCTCCTTCCTCACTGTG
CTCGTCTTCTACCTGCCCTCCGACTGCGGTGAGAAGGTGACCCTGTGCATTTCTGTCCTC
CTCTCCCTGACGGTGTTTCTCCTGGTGATCACTGAGACCATCCCTTCCACCTCGCTGGTC
ATCCCCCTGATTGGAGAGTACCTCCTGTTCACCATGATTTTTGTAACCTTGTCCATCGTC
ATCACCGTCTTCGTGCTCAACGTGCACTACAGAACCCCGACGACACACACAATGCCCTCA
TGGGTGAAGACTGTATTCTTGAACCTGCTCCCCAGGGTCATGTTCATGACCAGGCCAACA
AGCAACGAGGGCAACGCTCAGAAGCCGAGGCCCCTCTACGGTGCCGAGCTCTCAAATCTG
AATTGCTTCAGCCGCGCAGAGTCCAAAGGCTGCAAGGAGGGCTACCCCTGCCAGGACGGG
ATGTGTGGTTACTGCCACCACCGCAGGATAAAAATCTCCAATTTCAGTGCTAACCTCACG
AGAAGCTCTAGTTCTGAATCTGTTGATGCTGTGCTGTCCCTCTCTGCTTTGTCACCAGAA
ATCAAAGAAGCCATCCAAAGTGTCAAGTATATTGCTGAAAATATGAAAGCACAAAATGAA
GCCAAAGAGATTCAAGATGATTGGAAGTATGTTGCCATGGTGATTGATCGTATTTTTCTG
TGGGTTTTCACCCTGGTGTGCATTCTAGGGACAGCAGGATTGTTTCTGCAACCCCTGATG
GCCAGGGAAGATGCATAA
GenBank Gene IDM86383
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1957
Chromosome Location15
Locus15q24
References
  1. Fornasari D, Chini B, Tarroni P, Clementi F: Molecular cloning of human neuronal nicotinic receptor alpha 3-subunit. Neurosci Lett. 1990 Apr 6;111(3):351-6. 2336208
  2. Mihovilovic M, Roses AD: Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor. Exp Neurol. 1991 Feb;111(2):175-80. 1989896
  3. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. 8906617
  4. Groot Kormelink PJ, Luyten WH: Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 1997 Jan 6;400(3):309-14. 9009220
  5. Rempel N, Heyers S, Engels H, Sleegers E, Steinlein OK: The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3). Hum Genet. 1998 Dec;103(6):645-53. 9921897
  6. Lev-Lehman E, Bercovich D, Xu W, Stockton DW, Beaudet AL: Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4. J Hum Genet. 2001;46(7):362-6. 11450844
  7. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. 16572171
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Lansdell SJ, Gee VJ, Harkness PC, Doward AI, Baker ER, Gibb AJ, Millar NS: RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells. Mol Pharmacol. 2005 Nov;68(5):1431-8. Epub 2005 Aug 24. 16120769
  10. Chanock SJ, Hunter DJ: Genomics: when the smoke clears ... Nature. 2008 Apr 3;452(7187):537-8. doi: 10.1038/452537a. 18385720
  11. Hung RJ, McKay JD, Gaborieau V, Boffetta P, Hashibe M, Zaridze D, Mukeria A, Szeszenia-Dabrowska N, Lissowska J, Rudnai P, Fabianova E, Mates D, Bencko V, Foretova L, Janout V, Chen C, Goodman G, Field JK, Liloglou T, Xinarianos G, Cassidy A, McLaughlin J, Liu G, Narod S, Krokan HE, Skorpen F, Elvestad MB, Hveem K, Vatten L, Linseisen J, Clavel-Chapelon F, Vineis P, Bueno-de-Mesquita HB, Lund E, Martinez C, Bingham S, Rasmuson T, Hainaut P, Riboli E, Ahrens W, Benhamou S, Lagiou P, Trichopoulos D, Holcatova I, Merletti F, Kjaerheim K, Agudo A, Macfarlane G, Talamini R, Simonato L, Lowry R, Conway DI, Znaor A, Healy C, Zelenika D, Boland A, Delepine M, Foglio M, Lechner D, Matsuda F, Blanche H, Gut I, Heath S, Lathrop M, Brennan P: A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25. Nature. 2008 Apr 3;452(7187):633-7. doi: 10.1038/nature06885. 18385738
  12. Thorgeirsson TE, Geller F, Sulem P, Rafnar T, Wiste A, Magnusson KP, Manolescu A, Thorleifsson G, Stefansson H, Ingason A, Stacey SN, Bergthorsson JT, Thorlacius S, Gudmundsson J, Jonsson T, Jakobsdottir M, Saemundsdottir J, Olafsdottir O, Gudmundsson LJ, Bjornsdottir G, Kristjansson K, Skuladottir H, Isaksson HJ, Gudbjartsson T, Jones GT, Mueller T, Gottsater A, Flex A, Aben KK, de Vegt F, Mulders PF, Isla D, Vidal MJ, Asin L, Saez B, Murillo L, Blondal T, Kolbeinsson H, Stefansson JG, Hansdottir I, Runarsdottir V, Pola R, Lindblad B, van Rij AM, Dieplinger B, Haltmayer M, Mayordomo JI, Kiemeney LA, Matthiasson SE, Oskarsson H, Tyrfingsson T, Gudbjartsson DF, Gulcher JR, Jonsson S, Thorsteinsdottir U, Kong A, Stefansson K: A variant associated with nicotine dependence, lung cancer and peripheral arterial disease. Nature. 2008 Apr 3;452(7187):638-42. doi: 10.1038/nature06846. 18385739
  13. Amos CI, Wu X, Broderick P, Gorlov IP, Gu J, Eisen T, Dong Q, Zhang Q, Gu X, Vijayakrishnan J, Sullivan K, Matakidou A, Wang Y, Mills G, Doheny K, Tsai YY, Chen WV, Shete S, Spitz MR, Houlston RS: Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1. Nat Genet. 2008 May;40(5):616-22. doi: 10.1038/ng.109. Epub 2008 Apr 2. 18385676