You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLysine-specific demethylase 5C
Synonyms
  • 1.14.11.-
  • DXS1272E
  • Histone demethylase JARID1C
  • JARID1C
  • Jumonji/ARID domain-containing protein 1C
  • Protein SmcX
  • Protein Xe169
  • SMCX
  • XE169
Gene NameKDM5C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037293|Lysine-specific demethylase 5C
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQQLKNCLSEAEACVSRALGLVSGQEAGP
HRVAGLQMTLTELRAFLDQMNNLPCAMHQIGDVKGVLEQVEAYQAEAREALASLPSSPGL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV
APSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIREAENIPVHLPNIQ
ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASSSTASSTTSICVCGQVLAGAGAL
QCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQRLQAEPR
PEEPPNYPAAPASDPLREGSGKDMPKVQGLLENGDSVTSPEKVAPEEGSGKRDLELLSSL
LPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLEL
EKAERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE
ETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
Number of residues1560
Molecular Weight175718.565
Theoretical pINot Available
GO Classification
Functions
  • zinc ion binding
  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
  • DNA binding
  • histone demethylase activity (H3-K4 specific)
Processes
  • rhythmic process
  • transcription, DNA-templated
  • negative regulation of transcription, DNA-templated
  • chromatin organization
  • histone H3-K4 demethylation
Components
  • nucleus
  • nucleoplasm
General FunctionZinc ion binding
Specific FunctionHistone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP41229
UniProtKB Entry NameKDM5C_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021734|Lysine-specific demethylase 5C (KDM5C)
ATGGAGCCGGGGTCCGACGATTTCCTACCGCCACCGGAGTGCCCGGTGTTCGAGCCTAGC
TGGGCCGAGTTCCGAGACCCTCTTGGCTACATCGCGAAAATCAGGCCCATCGCAGAGAAA
TCGGGCATTTGCAAGATCCGCCCACCCGCGATTGTGGTGGAGGAAGGTGGTTATGAAGCT
ATCTGCAAGGACCGTCGGTGGGCTCGGGTAGCCCAGCGCCTCAACTATCCACCAGGCAAA
AATATTGGCTCCTTGCTACGCTCCCACTACGAACGCATTGTTTATCCCTATGAAATGTAC
CAGTCTGGAGCCAACCTTGTGCAGTGTAACACACGTCCATTTGATAATGAGGAGAAGGAC
AAGGAATACAAACCCCACAGCATCCCCCTACGACAGTCTGTGCAGCCTTCCAAGTTCAAC
AGCTATGGCCGGCGGGCCAAGAGACTGCAGCCTGATCCGGAACCCACAGAGGAAGACATT
GAGAAGAATCCAGAGCTGAAAAAGCTACAGATCTATGGGGCAGGCCCCAAGATGATGGGC
CTGGGCCTCATGGCCAAAGACAAGACTCTGCGGAAGAAAGATAAGGAGGGGCCTGAGTGT
CCCCCCACAGTAGTGGTGAAGGAGGAGTTAGGTGGGGATGTGAAGGTGGAGTCAACATCG
CCTAAGACCTTCCTGGAGAGCAAGGAGGAGCTGAGTCACAGCCCAGAACCCTGCACCAAG
ATGACCATGAGGCTACGGAGGAACCACAGCAATGCCCAGTTTATTGAGTCATATGTCTGC
CGGATGTGTTCTCGAGGGGATGAGGATGACAAGCTCCTGCTGTGTGATGGCTGTGATGAC
AACTACCACATCTTCTGCCTGCTGCCTCCTCTGCCTGAGATCCCCAAGGGTGTCTGGCGG
TGCCCAAAGTGTGTCATGGCGGAGTGTAAGCGGCCCCCAGAAGCCTTTGGCTTTGAGCAG
GCTACCCGGGAATACACTCTGCAGAGCTTTGGCGAGATGGCCGACTCCTTTAAAGCTGAC
TACTTCAACATGCCCGTGCATATGGTGCCCACAGAACTTGTGGAGAAGGAGTTCTGGAGG
CTGGTAAATAGCATTGAGGAAGATGTGACTGTTGAGTATGGAGCTGACATCCATTCCAAA
GAATTTGGCAGCGGTTTCCCTGTCAGTGACAGTAAACGGCACCTAACCCCCGAAGAGGAG
GAGTATGCTACCAGTGGTTGGAACCTAAATGTGATGCCGGTGTTGGAACAGTCTGTACTG
TGCCACATCAATGCAGATATCTCTGGCATGAAGGTGCCCTGGCTCTACGTGGGCATGGTC
TTCTCAGCCTTTTGCTGGCATATTGAGGATCACTGGAGTTACTCCATTAACTACCTCCAC
TGGGGTGAGCCGAAGACCTGGTATGGGGTGCCCTCACTTGCAGCAGAACATTTGGAAGAA
GTGATGAAGAAGCTGACACCTGAACTATTTGATAGCCAGCCTGACCTCCTGCACCAACTT
GTCACCCTCATGAATCCCAACACCCTCATGTCCCATGGTGTGCCAGTTGTCCGCACAAAC
CAGTGTGCAGGAGAGTTTGTCATCACCTTCCCCCGTGCTTACCACAGCGGCTTCAACCAA
GGCTACAACTTTGCCGAGGCTGTCAACTTTTGCACTGCTGACTGGTTGCCTGCTGGGCGC
CAGTGCATTGAGCACTACCGCCGGCTCCGGAGATACTGCGTCTTCTCCCATGAGGAGCTT
ATCTGCAAGATGGCTGCCTGCCCAGAGAAGCTAGACCTGAACCTGGCGGCAGCTGTGCAT
AAGGAGATGTTCATCATGGTGCAAGAAGAGCGGCGTCTACGAAAGGCCCTGCTGGAGAAG
GGTATCACAGAGGCTGAGCGAGAGGCTTTCGAGCTGCTCCCAGATGATGAGCGCCAGTGT
ATCAAGTGCAAGACTACGTGTTTCCTGTCAGCCCTGGCCTGCTACGACTGCCCAGACGGC
CTTGTCTGCCTTTCCCACATCAATGATCTCTGCAAGTGCTCCAGTAGCCGGCAGTACCTG
CGGTATCGGTATACCTTGGATGAGCTTCCTGCCATGCTGCATAAGCTGAAGGTTCGGGCT
GAGTCCTTTGACACCTGGGCCAACAAAGTGCGAGTGGCCCTGGAGGTGGAGGATGGGCGG
AAGCGCAGCCTTGAAGAACTGAGGGCACTAGAGTCTGAAGCCCGTGAGCGGAGGTTTCCT
AATAGTGAGCTGCTGCAGCAACTAAAGAACTGCCTGAGTGAGGCAGAGGCTTGCGTGTCC
CGAGCTCTGGGACTGGTCAGCGGCCAGGAAGCTGGCCCCCACAGGGTGGCTGGTCTACAG
ATGACCCTGACTGAGCTCCGGGCCTTTCTGGACCAGATGAACAACCTGCCTTGCGCCATG
CACCAGATTGGGGATGTCAAGGGTGTTCTGGAACAGGTGGAGGCCTACCAGGCTGAGGCT
CGTGAGGCCCTGGCCTCACTGCCCTCCAGTCCAGGGCTACTGCAGTCCCTGTTGGAGAGG
GGGCGGCAGCTGGGGGTGGAGGTGCCTGAGGCCCAGCAGCTCCAGCGGCAGGTGGAACAG
GCGCGATGGCTGGATGAGGTGAAACGCACACTGGCCCCCTCAGCCCGAAGGGGCACCTTG
GCTGTCATGCGAGGACTGTTGGTCGCGGGTGCCAGTGTAGCCCCTAGCCCTGCTGTGGAT
AAAGCCCAGGCCGAGCTGCAGGAACTGCTGACCATTGCTGAACGCTGGGAGGAGAAAGCC
CACCTCTGCCTGGAGGCCAGGCAGAAGCATCCACCAGCCACACTTGAGGCCATAATCCGT
GAAGCGGAAAACATCCCTGTTCACCTGCCCAACATCCAGGCTCTCAAGGAGGCTCTTGCT
AAGGCCCGGGCCTGGATTGCTGATGTTGATGAGATCCAAAATGGTGACCACTACCCCTGC
CTGGATGACTTGGAGGGCCTAGTAGCTGTGGGCCGGGACCTACCTGTGGGGCTGGAGGAG
CTGAGACAGCTAGAGCTACAGGTACTGACAGCGCACTCCTGGAGGGAGAAGGCCTCCAAG
ACCTTCCTCAAGAAAAATTCTTGCTACACGCTGCTGGAGGTTCTCTGCCCATGTGCAGAT
GCCGGCTCAGACAGCACCAAGCGCAGCCGGTGGATGGAGAAGGAGCTGGGGTTGTACAAA
TCTGACACAGAGCTGCTGGGGCTGTCTGCGCAGGACCTCAGGGACCCAGGCTCTGTGATC
GTGGCCTTCAAGGAGGGGGAACAGAAGGAGAAGGAGGGTATCCTGCAGCTGCGTCGCACC
AATTCGGCCAAGCCCAGTCCACTGGCATCATCGAGCACGGCCTCCTCTACAACCTCTATC
TGTGTGTGTGGGCAGGTGCTGGCTGGGGCGGGAGCTCTGCAGTGTGACCTGTGTCAGGAC
TGGTTCCATGGGCGGTGTGTGTCAGTGCCTCGCCTCCTCAGCTCTCCGAGGCCCAATCCC
ACCTCATCCCCACTGCTGGCCTGGTGGGAATGGGACACCAAATTCCTGTGTCCACTGTGT
ATGCGCTCAAGGCGCCCGCGCCTGGAGACCATCCTGGCACTGCTGGTAGCCCTGCAGAGA
CTGCCTGTGCGGCTGCCCGAGGGCGAGGCCCTGCAGTGCCTCACAGAGAGGGCCATCAGC
TGGCAAGGCCGCGCCAGGCAGGCTCTGGCCTCTGAAGATGTGACTGCTCTTTTGGGACGG
CTGGCTGAGCTCCGCCAACGGCTACAGGCTGAACCTAGACCTGAGGAGCCTCCTAACTAC
CCTGCAGCCCCTGCTTCTGACCCCCTCAGAGAGGGCAGTGGCAAGGATATGCCTAAGGTC
CAGGGCTTACTGGAGAATGGAGACAGTGTGACCAGTCCTGAGAAGGTAGCCCCGGAGGAG
GGCTCAGATCTGGAGCTGCTGTCCTCGCTGTTGCCACAGTTGACTGGCCCTGTGTTGGAA
CTGCCTGAGGCAACCCGGGCCCCCTTGGAGGAGCTCATGATGGAGGGGGACCTGCTCGAG
GTGACCCTGGATGAGAACCACAGCATCCCTGAGTCCCTTGACTTTTGTATTCTGACTCCA
AGGTATTGTTCAGACCTCAGCTCCTGGGGGCCGGCCCCTGGAGTCTTCCCTCCCTGGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:11114
Chromosome LocationX
LocusNot Available
References
  1. Wu J, Ellison J, Salido E, Yen P, Mohandas T, Shapiro LJ: Isolation and characterization of XE169, a novel human gene that escapes X-inactivation. Hum Mol Genet. 1994 Jan;3(1):153-60. 8162017
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. 15772651
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Agulnik AI, Mitchell MJ, Mattei MG, Borsani G, Avner PA, Lerner JL, Bishop CE: A novel X gene with a widely transcribed Y-linked homologue escapes X-inactivation in mouse and human. Hum Mol Genet. 1994 Jun;3(6):879-84. 7951230
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  7. Christensen J, Agger K, Cloos PA, Pasini D, Rose S, Sennels L, Rappsilber J, Hansen KH, Salcini AE, Helin K: RBP2 belongs to a family of demethylases, specific for tri-and dimethylated lysine 4 on histone 3. Cell. 2007 Mar 23;128(6):1063-76. Epub 2007 Feb 22. 17320161
  8. Iwase S, Lan F, Bayliss P, de la Torre-Ubieta L, Huarte M, Qi HH, Whetstine JR, Bonni A, Roberts TM, Shi Y: The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases. Cell. 2007 Mar 23;128(6):1077-88. Epub 2007 Feb 22. 17320160
  9. Tahiliani M, Mei P, Fang R, Leonor T, Rutenberg M, Shimizu F, Li J, Rao A, Shi Y: The histone H3K4 demethylase SMCX links REST target genes to X-linked mental retardation. Nature. 2007 May 31;447(7144):601-5. Epub 2007 Apr 29. 17468742
  10. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  11. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  12. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  13. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  14. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  15. Jensen LR, Amende M, Gurok U, Moser B, Gimmel V, Tzschach A, Janecke AR, Tariverdian G, Chelly J, Fryns JP, Van Esch H, Kleefstra T, Hamel B, Moraine C, Gecz J, Turner G, Reinhardt R, Kalscheuer VM, Ropers HH, Lenzner S: Mutations in the JARID1C gene, which is involved in transcriptional regulation and chromatin remodeling, cause X-linked mental retardation. Am J Hum Genet. 2005 Feb;76(2):227-36. Epub 2004 Dec 7. 15586325
  16. Santos C, Rodriguez-Revenga L, Madrigal I, Badenas C, Pineda M, Mila M: A novel mutation in JARID1C gene associated with mental retardation. Eur J Hum Genet. 2006 May;14(5):583-6. 16538222
  17. Tzschach A, Lenzner S, Moser B, Reinhardt R, Chelly J, Fryns JP, Kleefstra T, Raynaud M, Turner G, Ropers HH, Kuss A, Jensen LR: Novel JARID1C/SMCX mutations in patients with X-linked mental retardation. Hum Mutat. 2006 Apr;27(4):389. 16541399
  18. Vissers LE, de Ligt J, Gilissen C, Janssen I, Steehouwer M, de Vries P, van Lier B, Arts P, Wieskamp N, del Rosario M, van Bon BW, Hoischen A, de Vries BB, Brunner HG, Veltman JA: A de novo paradigm for mental retardation. Nat Genet. 2010 Dec;42(12):1109-12. doi: 10.1038/ng.712. Epub 2010 Nov 14. 21076407
  19. Grafodatskaya D, Chung BH, Butcher DT, Turinsky AL, Goodman SJ, Choufani S, Chen YA, Lou Y, Zhao C, Rajendram R, Abidi FE, Skinner C, Stavropoulos J, Bondy CA, Hamilton J, Wodak S, Scherer SW, Schwartz CE, Weksberg R: Multilocus loss of DNA methylation in individuals with mutations in the histone H3 lysine 4 demethylase KDM5C. BMC Med Genomics. 2013 Jan 28;6:1. doi: 10.1186/1755-8794-6-1. 23356856
  20. Brookes E, Laurent B, Ounap K, Carroll R, Moeschler JB, Field M, Schwartz CE, Gecz J, Shi Y: Mutations in the intellectual disability gene KDM5C reduce protein stability and demethylase activity. Hum Mol Genet. 2015 May 15;24(10):2861-72. doi: 10.1093/hmg/ddv046. Epub 2015 Feb 9. 25666439